DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4408 and cpb2

Sequence 1:NP_651141.2 Gene:CG4408 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001018539.2 Gene:cpb2 ZFINID:ZDB-GENE-050522-259 Length:424 Species:Danio rerio

Alignment Length:405 Identity:133/406 (33%)
Similarity:217/406 (53%) Gaps:34/406 (8%)


  Fly    83 HTRIYQVELASEEHVRLFQALEQASDSCSFMGHARQP--------GQKLTIMVTGAKVADFDDLV 139
            |.::..:.::|:|||...|.|...:::..:     ||        ..::.:.:....|....:.:
Zfish    26 HDQVLAITVSSQEHVEKVQNLTSHNETALW-----QPASPNYITTNSEVHLYIQSTSVQFVKEHL 85

  Fly   140 HSYNVTHRVLNYNFQALIDANYLEVAPEDTKPEEFDWKRYHPLESINAWLKKLAETHPE-VLLVE 203
            ..:.:|.|||..|..||: |..:.....|.:.....::|||.||.|..|:.|.:..|.: |.::.
Zfish    86 REHAITFRVLVENTAALV-AMQIRNDTSDPRSGGVFYERYHSLEDIYYWINKTSREHSDMVKVIL 149

  Fly   204 LGVSAQGRPILGVQIAFDNE---NRTTVFVESGIHAREWIAPATATYIIDQLV--NSKDSAVQAL 263
            :|.|::.||:..::::...|   || .::::.|||||||||||...:.::..:  .::::.:..:
Zfish   150 IGSSSEKRPLYVLKLSGKREEEVNR-AMWMDCGIHAREWIAPAFCMWFVNYALAFYNQNTEITEM 213

  Fly   264 ARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRA--LFGICRGVDLNRNFPFHWNVTGASGDPCRYD 326
            ......||...:|||||:||:..||||||||:  ....|.||||||||..:|...|||.|||...
Zfish   214 LNKMDIYILTVMNPDGYKYTWTTDRMWRKNRSENKDSYCAGVDLNRNFDANWCTKGASDDPCDPT 278

  Fly   327 YSGPSAASEVETQRMIEFIR-HRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKL 390
            |.|....||.|||.:.:|:| |:   :.::.::|:||||||::|||..|...:.|:::|.::.|.
Zfish   279 YCGQFPESEPETQAVAKFLRSHK---DTVKLYLSIHSYSQMLLFPYSCSYNEIPNHNELFELVKE 340

  Fly   391 AANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYEL--RGPADSEDLFILSAKE 453
            |:.||:......||.||..:|||.:.|||.|||: .|.|..:|::||  ||...    |:|....
Zfish   341 ASTKIRRYYRNNYKYGSGAKTIYLAPGGSDDWAY-DLGIKYSFTFELQDRGQYG----FLLPPSF 400

  Fly   454 IEPTAAEAFASIQTI 468
            |.....||..:.:.|
Zfish   401 IPQACNEALLAAKVI 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 16/79 (20%)
M14_CP_A-B_like 179..472 CDD:199844 113/302 (37%)
cpb2NP_001018539.2 Propep_M14 32..98 CDD:280416 13/71 (18%)
M14_CPB2 120..420 CDD:199868 114/306 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70881082
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11705
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.