DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pnt and Ets96B

Sequence 1:NP_524461.2 Gene:pnt FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster

Alignment Length:489 Identity:123/490 (25%)
Similarity:193/490 (39%) Gaps:108/490 (22%)


  Fly   260 GNSFESATTASVCGS------------------DHQVAN------YPNETHA-------NSNNSS 293
            |:|.....:||:|..                  .||:.:      .|..|.|       .|....
  Fly   163 GSSSAGGASASLCNDLTRESSWYAHHHHHHHHHHHQLPDELVMYATPTPTPAIGKFGLDTSTEGY 227

  Fly   294 INSRLSMDYVTSAGNSDNKNFH--RATPHSHNGYNTSNTHDRIN------NSTPPQ--QQQSQQP 348
            :|:|.::: |....:....:|.  .|..|.|| :...:.|...:      .|:||.  .::|.:.
  Fly   228 LNARYNVN-VKGVRHDRTSSFFDIPAVTHPHN-HPHPHPHPHPHPYCYRFPSSPPAGILKKSDEE 290

  Fly   349 TVNGSGSASSNNNNSMLPPAVQQSNNENNNTSSSNTNNSSNNNNNSGGSNNSNAGSNNNNNNNNN 413
            ..:.:...|..::....|...:..:.::..|::.............         ........:.
  Fly   291 ATSAAVYCSDVSSGQHFPHHTKIEHADSTTTAAQQQQQQQEQQQQQ---------QQQQQQQQHQ 346

  Fly   414 INFMAAAAIFQHHLKEEPGTQNGNIGGYGGGSNSQNDPTDLSSYGLPAHLAAYGGGSGSGPTGGR 478
            .....|||:..||       .:.:.|.:|.....|...|.|:    |.|.|:....|.:...   
  Fly   347 QQLQQAAALHPHH-------HHSHHGHHGHQQAEQQALTHLT----PLHAASAFKFSHTAVI--- 397

  Fly   479 SSGGGGDESDYHSTISAQDHQSQQSSGGNGSGGASGGSTGNSNGYLDSSSEFYGSYAGRNRFHDG 543
                  ..|..::|.|...||.|               |.:.:.|.|.|.....:.:..:..:|.
  Fly   398 ------SSSAVYATPSHYAHQQQ---------------TQSQSVYRDLSPTTLAAVSDADLKYDS 441

  Fly   544 YPPEFTPYDAQSFQSMGP---QPTAMDQWGAAHAHQHPAAYMSTLGLDKGLLGGYTTQGGVPCFT 605
                 .||:| :..|..|   :|..:|...::.|......:.::.|:.       |:..|.....
  Fly   442 -----GPYNA-AISSTYPSALRPNVVDSTTSSDAELRLDQFYASNGIS-------TSSNGQAISQ 493

  Fly   606 GSGPIQLWQFLLELLLDKTCQ-SFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLR 669
            ..|.:||||||:.||.:.|.. |.|:|||.|.||||.:|:|||||||::||:|.|||:||||.||
  Fly   494 RRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLR 558

  Fly   670 YYYDKNIIHKTAGKRYVYRFVCD---LQNLV-GH 699
            |||:|.|:.|..|:|||||||||   |.|:. ||
  Fly   559 YYYEKGIMQKVNGERYVYRFVCDPDALFNMAYGH 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 55/88 (63%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 55/86 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C129178791
eggNOG 1 0.900 E1_KOG3806
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11849
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.