DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZNF264

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_003408.1 Gene:ZNF264 HGNCID:13057 Length:627 Species:Homo sapiens

Alignment Length:519 Identity:125/520 (24%)
Similarity:189/520 (36%) Gaps:142/520 (27%)


  Fly   231 GSEPET-KPQVKEDASP---SRSKTKALPKRRPSL---------------VDANLKATEAR---K 273
            |.||.| |..:.:|..|   .:.||.......|:|               ||:.|...|.:   .
Human    69 GQEPWTRKEDLSQDTCPGDKGKPKTTEPTTCEPALSEGISLQGQVTQGNSVDSQLGQAEDQDGLS 133

  Fly   274 DAKEEEFILGCNTDPANNS----DVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDN----GE 330
            :.:|..|..|  .||...|    ....|||...:.|.:..|::    .:...|.|.:.|    |:
Human   134 EMQEGHFRPG--IDPQEKSPGKMSPECDGLGTADGVCSRIGQE----QVSPGDRVRSHNSCESGK 192

  Fly   331 IYIINSASSEDQNQDSTPE----FDQ----------DNGITSYNIKEDGE------------IQF 369
            ..:|    .|::|.....|    |::          .:|:..|...|.|:            :..
Human   193 DPMI----QEEENNFKCSECGKVFNKKHLLAGHEKIHSGVKPYECTECGKTFIKSTHLLQHHMIH 253

  Fly   370 SGEKPEE-IEDVVVFNLGEEISQEQQV---------------FSFHENVIIVEKEQNDR-----D 413
            :||:|.| :|....||....::|.|::               |:...|.::..:.....     .
Human   254 TGERPYECMECGKAFNRKSYLTQHQRIHSGEKPYKCNECGKAFTHRSNFVLHNRRHTGEKSFVCT 318

  Fly   414 EQTPLKRKRSSEL-------------------VFKQESSC---PQPKTGR--------------- 441
            |...:.|.|...|                   |||..|..   .|..||.               
Human   319 ECGQVFRHRPGFLRHYVVHSGENPYECLECGKVFKHRSYLMWHQQTHTGEKPYECSECGKVFLES 383

  Fly   442 --------ITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSL 498
                    |....|.|:|..|..||..:..|.||...| .|.|     ...|..|....:..|:.
Human   384 AALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRIH-TGEK-----PFVCSECGKAFTHCSTF 442

  Fly   499 KRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHM 563
            ..|...|||.|||:|.||..:||.|:.|.||...|||.|.::|.:|...|.:.|.|.:| .|:|.
Human   443 ILHKRAHTGEKPFECKECGKAFSNRKDLIRHFSIHTGEKPYECVECGKAFTRMSGLTRH-KRIHS 506

  Fly   564 GNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKLT 626
            | .:.::|..|.:||...:.|.||.:.|.|.. :.|.:||:.|:..|::.:| ..||..||.::
Human   507 G-EKPYECVECGKSFCWSTNLIRHAIIHTGEKPYKCSECGKAFSRSSSLTQH-QRMHTGKNPIS 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 6/14 (43%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 28/76 (37%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
ZNF264NP_003408.1 KRAB 14..74 CDD:214630 3/5 (60%)
KRAB 14..53 CDD:279668
COG5048 184..568 CDD:227381 97/397 (24%)
C2H2 Zn finger 205..225 CDD:275368 2/20 (10%)
zf-H2C2_2 221..240 CDD:290200 4/19 (21%)
C2H2 Zn finger 233..253 CDD:275368 2/20 (10%)
zf-H2C2_2 245..270 CDD:290200 7/25 (28%)
C2H2 Zn finger 261..281 CDD:275368 5/20 (25%)
zf-H2C2_2 273..298 CDD:290200 3/25 (12%)
C2H2 Zn finger 289..309 CDD:275368 2/20 (10%)
C2H2 Zn finger 317..337 CDD:275368 4/20 (20%)
zf-C2H2 343..365 CDD:278523 5/22 (23%)
C2H2 Zn finger 345..365 CDD:275368 5/20 (25%)
zf-H2C2_2 357..380 CDD:290200 3/23 (13%)
C2H2 Zn finger 373..393 CDD:275368 1/20 (5%)
zf-C2H2 399..421 CDD:278523 8/22 (36%)
C2H2 Zn finger 401..421 CDD:275368 7/20 (35%)
zf-H2C2_2 413..438 CDD:290200 8/31 (26%)
C2H2 Zn finger 429..449 CDD:275368 4/20 (20%)
zf-H2C2_2 445..466 CDD:290200 12/21 (57%)
C2H2 Zn finger 457..477 CDD:275368 9/20 (45%)
zf-H2C2_2 469..494 CDD:290200 10/25 (40%)
C2H2 Zn finger 485..505 CDD:275368 7/21 (33%)
zf-H2C2_2 498..520 CDD:290200 8/24 (33%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 525..550 CDD:290200 9/25 (36%)
C2H2 Zn finger 541..561 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.