DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Mynn

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_085034.2 Gene:Mynn MGIID:1931415 Length:610 Species:Mus musculus

Alignment Length:638 Identity:154/639 (24%)
Similarity:240/639 (38%) Gaps:163/639 (26%)


  Fly    63 CRYQLEKSFLFRQR-----CQW----AEKKLRKHIRLLG-----LGKRSRVFSKDPDDYDEDELE 113
            |.:.||:  |.:||     |..    .|.:.:.|..:|.     .|...|..|::....|:.:::
Mouse     7 CEHLLER--LNKQREAGFLCDCTVVIGEFQFKAHRNVLASFSEYFGAIYRSTSENNVFLDQSQVK 69

  Fly   114 ---FEDSIAFIEVQDKVRKLEDEKWREDFKE-EQAAEMHKRLVKSRLELRAKLTTELRKELAEEV 174
               |:..:.||    ....|..:.|  :.|| .|||:..|                     .|||
Mouse    70 ADGFQKLLEFI----YTGTLNLDSW--NVKEIHQAADYLK---------------------VEEV 107

  Fly   175 --RSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETK 237
              :.:::.|....:.|....:: :.::.:|...|.|.|| .|..|...:|:.  .|.|..:...|
Mouse   108 VTKCKIKMEDFAFIASPSSTEI-SSITGNIELNQQACLL-TLRDYNNREKSE--VSTDSVQANPK 168

  Fly   238 PQ-VKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLEL 301
            |: :.:.:|.|:.|.||...::|    ...||.:...|..|                        
Mouse   169 PRALTKKSSQSKKKKKAFSSQKP----GQSKAVQYPSDVLE------------------------ 205

  Fly   302 DEEVPAESGEDFREINMVGSDVVH-----TDNGEI----YIINSASSEDQNQDSTPEFDQDNGIT 357
                 :.|.|.|.|.:.:.|.||.     .|:.|:    .:.|:..::|..|..|.:..:....:
Mouse   206 -----SASVELFLETSKLSSPVVEQIIQGNDSSELELTSVVENTFPTQDIVQTVTVKRKRRKSQS 265

  Fly   358 SYNIKEDGEIQFSGEK-PEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRK 421
            ...:||......:..| |.|:|     |.|||:...   ||                     |.|
Mouse   266 HCALKEHSMSNIASVKSPYELE-----NAGEELDAR---FS---------------------KAK 301

  Fly   422 ---RSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHI----------- 472
               .:...||.:.||..:..  ||...||.:.||||..||.....|..|..||.           
Mouse   302 PMCNTCGKVFSEASSLRRHM--RIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGERPYKCELCD 364

  Fly   473 KG------------LKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREV 525
            ||            :..|:....||..|.||.:.:|:||.|...|:|.||:.|..|...|:|...
Mouse   365 KGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQAST 429

  Fly   526 LKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVT 590
            |..|:..|||.|.:.|..|...||..|:|..| .|.|.| .:.:.|.:|.:||.....|::|..:
Mouse   430 LTYHVRRHTGEKPYVCDTCGKAFAVSSSLITH-SRKHTG-EKPYICGICGKSFISSGELNKHFRS 492

  Fly   591 HAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTD------YISETNEFQ 636
            |.|.. |.|:.||..:.|...:::|.|.:|...:|..|      .:||.:..|
Mouse   493 HTGERPFICELCGNSYTDIKNLKKHKTKVHSGTDKNPDCSVDDHAVSEQDSVQ 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 8/32 (25%)
vATP-synt_E 109..>244 CDD:304907 28/142 (20%)
RRF <161..222 CDD:294170 12/63 (19%)
zf-C2H2_8 454..530 CDD:292531 29/99 (29%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
MynnNP_085034.2 BTB 14..115 CDD:279045 25/128 (20%)
BTB 25..118 CDD:197585 22/120 (18%)
Nuclear localization signal. {ECO:0000255} 174..190 5/16 (31%)
Nuclear localization signal. {ECO:0000255} 257..262 0/5 (0%)
C2H2 Zn finger 304..324 CDD:275368 6/22 (27%)
zf-C2H2 304..324 CDD:278523 6/22 (27%)
zf-H2C2_2 316..341 CDD:290200 11/27 (41%)
C2H2 Zn finger 332..352 CDD:275368 9/20 (45%)
zf-H2C2_2 345..369 CDD:290200 6/24 (25%)
C2H2 Zn finger 360..380 CDD:275368 2/20 (10%)
C2H2 Zn finger 389..409 CDD:275368 8/20 (40%)
zf-H2C2_2 401..426 CDD:290200 10/25 (40%)
C2H2 Zn finger 417..437 CDD:275368 6/20 (30%)
zf-H2C2_2 430..453 CDD:290200 9/23 (39%)
C2H2 Zn finger 445..465 CDD:275368 8/21 (38%)
zf-H2C2_2 457..482 CDD:290200 9/27 (33%)
C2H2 Zn finger 473..493 CDD:275368 6/20 (30%)
C2H2 Zn finger 501..522 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.