DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZBTB3

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_079060.1 Gene:ZBTB3 HGNCID:22918 Length:574 Species:Homo sapiens

Alignment Length:435 Identity:86/436 (20%)
Similarity:144/436 (33%) Gaps:116/436 (27%)


  Fly   144 AAEMHK----RLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRK 204
            |:.:|.    ::.|.||:.||         |||  ....:||  ||..||:..  ...:|...|.
Human   153 ASYLHMNDIVKVCKRRLQARA---------LAE--ADSTKKE--EETNSQLPS--LEFLSSTSRG 202

  Fly   205 EQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKA--------LPKRRPSL 261
            .|.::...|...:..:   |.|:......|..:|..:...|.....|:.        |....|.:
Human   203 TQPSLASAETSGHWGK---GEWKGSAAPSPTVRPPDEPPMSSGADTTQPGMEVDAPHLRAPHPPV 264

  Fly   262 VDANLKATEARKDAKEEEF----ILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSD 322
            .|.:|.:..:..:.....:    |...:.:|..:.||..:.|.:.|  |.:.|...:        
Human   265 ADVSLASPSSSTETIPTNYFSSGISAVSLEPLPSLDVGPESLRVVE--PKDPGGPLQ-------- 319

  Fly   323 VVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGE 387
                   ..|...||.:......|.|                  :......|.|.|.|.|     
Human   320 -------GFYPPASAPTSAPAPVSAP------------------VPSQAPAPAEAELVQV----- 354

  Fly   388 EISQEQQVFSFHENVIIVEKEQNDRDEQT--PLKRKRSSELVFKQESSCPQ----PKTGRITD-- 444
                  :|    |.::|.::|.:..|||.  |.:...|...|:..:.|.|:    |....:.:  
Human   355 ------KV----EAIVISDEETDVSDEQPQGPERAFPSGGAVYGAQPSQPEAFEDPGAAGLEEVG 409

  Fly   445 -------TVKSFQCHLCP---------VAFPTQKLLTRHHNTHIKGLKSGKGGTL--------KC 485
                   |......||.|         |..|.....:.|...::........|:.        .|
Human   410 PSDHFLPTDPHLPYHLLPGAGQYHRGLVTSPLPAPASLHEPLYLSSEYEAAPGSFGVFTEDVPTC 474

  Fly   486 PSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHM 530
            .:|....||:.:|:||..:||..:|::|..|..|::|...|.||:
Human   475 KTCGKTFSCSYTLRRHATVHTRERPYECRYCLRSYTQSGDLYRHI 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 24/104 (23%)
RRF <161..222 CDD:294170 13/61 (21%)
zf-C2H2_8 454..530 CDD:292531 22/93 (24%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 3/6 (50%)
C2H2 Zn finger 541..562 CDD:275368
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
ZBTB3NP_079060.1 BTB 64..170 CDD:279045 5/17 (29%)
BTB 75..169 CDD:197585 4/16 (25%)
DUF3597 323..>359 CDD:289008 11/69 (16%)
C2H2 Zn finger 474..494 CDD:275368 7/20 (35%)
zf-H2C2_2 487..511 CDD:290200 9/24 (38%)
C2H2 Zn finger 502..520 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.