DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZNF189

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_003443.2 Gene:ZNF189 HGNCID:12980 Length:626 Species:Homo sapiens

Alignment Length:675 Identity:144/676 (21%)
Similarity:233/676 (34%) Gaps:212/676 (31%)


  Fly   101 SKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRLELRAKLTTE 165
            |..|....:..|.|||...|         ...|:|  |:.:.....::|.::.........|.. 
Human     3 SPSPPPESKGLLTFEDVAVF---------FTQEEW--DYLDPAQRSLYKDVMMENYGNLVSLDV- 55

  Fly   166 LRKELAEE--VRSEVRKELAEEVRSQ--VRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAG-- 224
            |.::..||  |:.|: :|:.|||..|  :...:::|:.:|....:...|:|.|     :|:.|  
Human    56 LNRDKDEEPTVKQEI-EEIEEEVEPQGVIVTRIKSEIDQDPMGRETFELVGRL-----DKQRGIF 114

  Fly   225 RWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKD-AKEEEFI------- 281
            .||....|..:.:...:|:.:        :.::||:..:...|..|..|. .::..||       
Human   115 LWEIPRESLTQEQRMFRENTN--------IIRKRPNSEEKCHKCEECGKGFVRKAHFIQHQRVHT 171

  Fly   282 ----LGCNTDPANNSDVNIDGLELDEEVPAESGEDF-REINMVGSDVVHTDN--------GEIYI 333
                ..||                      |.|:.| |...::....:||..        |:.:.
Human   172 GEKPFQCN----------------------ECGKSFSRSSFVIEHQRIHTGERPYECNYCGKTFS 214

  Fly   334 INSASSEDQ-----------NQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDV-VVFNLG 386
            ::|.....|           || ....|.|...:..:      :...:||||.:..|. ..|:..
Human   215 VSSTLIRHQRIHTGERPYQCNQ-CKQSFSQRRSLVKH------QRIHTGEKPHKCSDCGKAFSWK 272

  Fly   387 EEISQEQQVF-------------SFHENVIIVEKEQNDRDEQTPLK------------------- 419
            ..:.:.|:..             ||..|.::||.::....|: |.|                   
Human   273 SHLIEHQRTHTGEKPYHCTKCKKSFSRNSLLVEHQRIHTGER-PHKCGECGKAFRLSTYLIQHQK 336

  Fly   420 ----------------RKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHH 468
                            ..|||.|:..|          ||....:.:||..|..:|.....||||.
Human   337 IHTGEKPFLCIECGKSFSRSSFLIEHQ----------RIHTGERPYQCKECGKSFSQLCNLTRHQ 391

  Fly   469 NTHI-----------KGLKSGKG---------------------------------------GTL 483
            ..|.           |......|                                       .:.
Human   392 RIHTGDKPHKCEECGKAFSRSSGLIQHQRIHTREKTYPYNETKESFDPNCSLVIQQEVYPKEKSY 456

  Fly   484 KCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCF 548
            ||..|....|.::.|.:|..||||.||:.|:.|..|||:...|..|...|||.:.:.|.||...|
Human   457 KCDECGKTFSVSAHLVQHQRIHTGEKPYLCTVCGKSFSRSSFLIEHQRIHTGERPYLCRQCGKSF 521

  Fly   549 AQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQ 612
            :|..||.:|.| ||.|| :.|||..|.::|:..|||.:|...|.|.. :.|::|.:.|:.:.::.
Human   522 SQLCNLIRHQG-VHTGN-KPHKCDECGKAFSRNSGLIQHQRIHTGEKPYKCEKCDKSFSQQRSLV 584

  Fly   613 RHVTTMHKVKNKLTDYISETNEFQA 637
            .|.....:||.:      ||:|..|
Human   585 NHQKIHAEVKTQ------ETHECDA 603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 31/141 (22%)
RRF <161..222 CDD:294170 17/65 (26%)
zf-C2H2_8 454..530 CDD:292531 28/126 (22%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 10/21 (48%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 4/19 (21%)
ZNF189NP_003443.2 KRAB 13..54 CDD:307490 10/52 (19%)
COG5048 138..524 CDD:227381 82/426 (19%)
C2H2 Zn finger 150..170 CDD:275368 4/20 (20%)
C2H2 Zn finger 178..198 CDD:275368 6/42 (14%)
C2H2 Zn finger 206..226 CDD:275368 3/20 (15%)
C2H2 Zn finger 234..254 CDD:275368 4/27 (15%)
C2H2 Zn finger 262..282 CDD:275368 3/20 (15%)
C2H2 Zn finger 290..310 CDD:275368 5/20 (25%)
C2H2 Zn finger 318..338 CDD:275368 0/20 (0%)
C2H2 Zn finger 346..366 CDD:275368 7/30 (23%)
C2H2 Zn finger 374..394 CDD:275368 7/20 (35%)
C2H2 Zn finger 402..422 CDD:275368 2/20 (10%)
C2H2 Zn finger 458..478 CDD:275368 6/20 (30%)
C2H2 Zn finger 486..506 CDD:275368 7/20 (35%)
C2H2 Zn finger 514..534 CDD:275368 10/21 (48%)
COG5048 537..>590 CDD:227381 16/54 (30%)
C2H2 Zn finger 542..562 CDD:275368 7/20 (35%)
zf-H2C2_2 555..579 CDD:316026 7/24 (29%)
C2H2 Zn finger 570..590 CDD:275368 4/20 (20%)
C2H2 Zn finger 601..621 CDD:275368 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.