DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp934

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_017171126.1 Gene:Zfp934 MGIID:1924367 Length:491 Species:Mus musculus

Alignment Length:561 Identity:135/562 (24%)
Similarity:203/562 (36%) Gaps:164/562 (29%)


  Fly    78 QWA-----EKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWRE 137
            :||     :|||.||:.|                   :.....::|.|             .|..
Mouse    35 EWALLDPSQKKLYKHVML-------------------ETYRNLNAIGF-------------NWEA 67

  Fly   138 DFKEE--QAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSE 200
            ...||  |::..|:|..:|:...:....|:..|..|....|..::.  |.:.::      ...||
Mouse    68 QNIEEHCQSSRRHRRCERSQSAEKPSEYTQRDKAFALSAHSHAQRH--ERIHTE------KIPSE 124

  Fly   201 DIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEP-ETKPQVKEDASPSRSKTKALPKRRPSLVDA 264
            ||...:..:....|:|:.        .:..|.:| |.|...|..|.||                 
Mouse   125 DIHCVEDVLPYTSLQVHK--------RTQTGQKPYECKQCGKGFAKPS----------------- 164

  Fly   265 NLKATEARKDAKEEEFILGCNTDPANNSDVNIDGL-----ELDEEVPAESGEDFREINMVGSDVV 324
            :||..| |....|:.|.  ||         ..|.:     .|...:...:||...:.|:.     
Mouse   165 HLKRHE-RYHTGEQPFT--CN---------ECDKVFSFKHHLQTHISIRTGEKPFKCNLC----- 212

  Fly   325 HTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEI 389
                                        |...:.:|..:......:||||.:.:           
Mouse   213 ----------------------------DKSFSKHNHLQSHRRTHTGEKPYKCD----------- 238

  Fly   390 SQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQE-------SSCPQPKTGRITDTVK 447
             |..:.||...|:            ||.: |..|.|..:|.:       ..|...|..||....|
Mouse   239 -QCDKAFSEKCNL------------QTHI-RIHSGEKPYKCDQCDKTFSEKCHLQKHIRIHTGEK 289

  Fly   448 SFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFK 512
            .::|:.|..||.....|..|..|| .|.|     ..||..|....|....|:.|...|||.||:|
Mouse   290 PYKCNQCDKAFSQYNTLKTHRRTH-TGEK-----PYKCNQCDKAFSQYGHLQTHRRTHTGEKPYK 348

  Fly   513 CSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRS 577
            |::|:.:|||...||.|..||||.|.::|.||...|::|.:||:|| |:|.| .:.:||:.|.::
Mouse   349 CNQCDKAFSQYNTLKTHRRTHTGEKPYKCNQCDKAFSEKCSLQRHI-RIHTG-EKPYKCNQCDKA 411

  Fly   578 FNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTT 617
            |:..|.|..|..||.|.. :.|.||.:.|:..|.:|.|..|
Mouse   412 FSQYSTLQTHRRTHTGEKPYKCNQCDKAFSQYSNLQTHRRT 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 5/13 (38%)
vATP-synt_E 109..>244 CDD:304907 25/138 (18%)
RRF <161..222 CDD:294170 11/61 (18%)
zf-C2H2_8 454..530 CDD:292531 29/76 (38%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 10/21 (48%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 7/19 (37%)
Zfp934XP_017171126.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.