DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZNF74

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001243453.1 Gene:ZNF74 HGNCID:13144 Length:644 Species:Homo sapiens

Alignment Length:613 Identity:156/614 (25%)
Similarity:229/614 (37%) Gaps:140/614 (23%)


  Fly    95 KRSRVFSKDP----DDYDED-------ELEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQA---- 144
            :::.:.|:||    .:..||       |...::|::|   :|.......|:|.:....::|    
Human     9 EKTALSSQDPALSLKENLEDISGWGLPEARSKESVSF---KDVAVDFTQEEWGQLDSPQRALYRD 70

  Fly   145 -------------AEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRN 196
                         ..:||..|.|.|| |.:....:::|:.   |....:...:.|.||.:...:.
Human    71 VMLENYQNLLALGPPLHKPDVISHLE-RGEEPWSMQREVP---RGPCPEWELKAVPSQQQGICKE 131

  Fly   197 E-VSEDIRKEQL--AMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKA---LP 255
            | ..|.|.:..|  |...|.....|...:|..|    ...|.....|..:..|.|....|   :|
Human   132 EPAQEPIMERPLGGAQAWGRQAGALQRSQAAPW----APAPAMVWDVPVEEFPLRCPLFAQQRVP 192

  Fly   256 KRRPSLVDA--NLKATEARKDAKEEEFILGCN----TDPANNSDVNID---GLELDEEVPAESGE 311
            :..| |:|.  |::|||.|..| ......|.|    ::|.....|...   |....|.|..|.|:
Human   193 EGGP-LLDTRKNVQATEGRTKA-PARLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGK 255

  Fly   312 DFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQ-DNGIT-SYNIKEDGEIQFSGEKP 374
            .||:.:   |..:|             ....:::...:.|: ....| |.|:.|...|. :||||
Human   256 AFRQSS---SLTLH-------------RRWHSREKAYKCDECGKAFTWSTNLLEHRRIH-TGEKP 303

  Fly   375 EEIEDVVVFNLGE---------EISQEQQV---------------------FSFHENVIIVEKEQ 409
                    |..||         .::..|::                     .|.|..|...||..
Human   304 --------FFCGECGKAFSCHSSLNVHQRIHTGERPYKCSACEKAFSCSSLLSMHLRVHTGEKPY 360

  Fly   410 ---------NDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTV--------KSFQCHLCPVA 457
                     |.|...|...|..:.|..: |..||.:..|...:.||        |.|:|..|..|
Human   361 RCGECGKAFNQRTHLTRHHRIHTGEKPY-QCGSCGKAFTCHSSLTVHEKIHSGDKPFKCSDCEKA 424

  Fly   458 FPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQ 522
            |.::..||.|..|| .|.|     ..||..|....||.:.|..|..||:|.|||||:||..:||.
Human   425 FNSRSRLTLHQRTH-TGEK-----PFKCADCGKGFSCHAYLLVHRRIHSGEKPFKCNECGKAFSS 483

  Fly   523 REVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRH 587
            ...|..|...|||.|...|.||...|:..|:|..| .|:|.| .:.:||..|.|:|:....|.:|
Human   484 HAYLIVHRRIHTGEKPFDCSQCWKAFSCHSSLIVH-QRIHTG-EKPYKCSECGRAFSQNHCLIKH 546

  Fly   588 LVTHAG-VMFSCKQCGRQFNDRSAVQRH 614
            ...|:| ..|.|::||..||..|.:..|
Human   547 QKIHSGEKSFKCEKCGEMFNWSSHLTEH 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 32/162 (20%)
RRF <161..222 CDD:294170 12/64 (19%)
zf-C2H2_8 454..530 CDD:292531 31/76 (41%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 14/25 (56%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
ZNF74NP_001243453.1 KRAB 43..103 CDD:214630 12/64 (19%)
KRAB 43..82 CDD:279668 5/42 (12%)
COG5048 <248..395 CDD:227381 34/173 (20%)
C2H2 Zn finger 250..270 CDD:275368 6/36 (17%)
zf-H2C2_2 262..286 CDD:290200 3/37 (8%)
C2H2 Zn finger 278..298 CDD:275368 6/20 (30%)
zf-H2C2_2 290..315 CDD:290200 10/34 (29%)
C2H2 Zn finger 306..326 CDD:275368 3/20 (15%)
zf-H2C2_2 318..343 CDD:290200 1/25 (4%)
COG5048 <331..511 CDD:227381 58/187 (31%)
C2H2 Zn finger 334..354 CDD:275368 3/20 (15%)
zf-H2C2_2 347..371 CDD:290200 6/24 (25%)
C2H2 Zn finger 362..382 CDD:275368 4/20 (20%)
zf-H2C2_2 374..399 CDD:290200 7/26 (27%)
C2H2 Zn finger 390..410 CDD:275368 5/20 (25%)
zf-H2C2_2 402..427 CDD:290200 8/25 (32%)
C2H2 Zn finger 418..438 CDD:275368 8/20 (40%)
zf-H2C2_2 431..455 CDD:290200 11/30 (37%)
C2H2 Zn finger 446..466 CDD:275368 7/20 (35%)
zf-H2C2_2 458..483 CDD:290200 14/25 (56%)
C2H2 Zn finger 474..494 CDD:275368 7/20 (35%)
zf-H2C2_2 486..511 CDD:290200 10/25 (40%)
C2H2 Zn finger 502..522 CDD:275368 8/21 (38%)
zf-H2C2_2 514..539 CDD:290200 10/27 (37%)
C2H2 Zn finger 530..550 CDD:275368 6/20 (30%)
zf-H2C2_2 543..566 CDD:290200 9/23 (39%)
C2H2 Zn finger 558..578 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.