DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZNF23

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001291421.1 Gene:ZNF23 HGNCID:13023 Length:643 Species:Homo sapiens

Alignment Length:578 Identity:128/579 (22%)
Similarity:217/579 (37%) Gaps:169/579 (29%)


  Fly   162 LTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEK-KAGR 225
            |.|:::.:      :::.||:.|. :..|..:|:.:.|::....:.::|..:.||:.... |..:
Human    45 LQTDIQTD------NDLTKEMYEG-KENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEK 102

  Fly   226 WESLDGSEPETKPQVKEDASP------SRSKTK----ALPKRRPS--------------LVDANL 266
            ..::||:       ||::.||      |:|...    .:...:||              ||...:
Human   103 SNTIDGT-------VKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEI 160

  Fly   267 KATEARKDAKEEEFI--LGCNTDPANNSDVNID-----------GLELDE-----------EVP- 306
            ..:|.| ..|.||.:  ..|::....:.:.|.:           ...::|           |.| 
Human   161 INSEER-PFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECGKAFSINEKLIWHQRLHSGEKPF 224

  Fly   307 --AESGEDFR-EINMVGSDVVHTDN--------GEIYIINSASSEDQNQDSTPEFDQDNGITSYN 360
              .|.|:.|. ..:.:....:|:..        |:.:.:|.:.|..|...:        |...|.
Human   225 KCVECGKSFSYSSHYITHQTIHSGEKPYQCKMCGKAFSVNGSLSRHQRIHT--------GEKPYQ 281

  Fly   361 IKEDGEIQFS-------------GEKPEEIEDV-VVFNLGEEISQEQQVFS-------------- 397
            .||.|. .||             ||||.|..|. ..||:..::.|.|::.:              
Human   282 CKECGN-GFSCSSAYITHQRVHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGF 345

  Fly   398 -------FHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCP 455
                   .|:::...||         |.:.|...: .|...:...|.:  ||....|.::|..|.
Human   346 RCSSQLRQHQSIHTGEK---------PYQCKECGK-GFNNNTKLIQHQ--RIHTGEKPYECTECG 398

  Fly   456 VAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSF 520
            .||..:..|.:|...| .|.|     ..:|..|.....|.|..::|:.||||.||::|:||..:|
Human   399 KAFSVKGKLIQHQRIH-TGEK-----PYECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAF 457

  Fly   521 SQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLS 585
            |....|.||...|||.|..:|.:|..||..|.||..| .|:|.| .:.::|..|.::|:..:.|:
Human   458 SVNGKLMRHQRIHTGEKPFECNECGRCFTSKRNLLDH-HRIHTG-EKPYQCKECGKAFSINAKLT 520

  Fly   586 RHLVTHAGVM-----------------------------FSCKQCGRQFNDRSAVQRH 614
            ||...|.|..                             |.||:||:.|:..:.:.||
Human   521 RHQRIHTGEKPFKCMECEKAFSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRH 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 16/83 (19%)
RRF <161..222 CDD:294170 11/61 (18%)
zf-C2H2_8 454..530 CDD:292531 27/76 (36%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 11/24 (46%)
C2H2 Zn finger 541..562 CDD:275368 9/21 (43%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 7/18 (39%)
ZNF23NP_001291421.1 KRAB_A-box <1..31 CDD:322003
C2H2 Zn finger 142..162 CDD:275368 2/20 (10%)
C2H2 Zn finger 170..190 CDD:275368 3/20 (15%)
COG5048 186..606 CDD:227381 98/423 (23%)
C2H2 Zn finger 198..218 CDD:275368 1/20 (5%)
C2H2 Zn finger 226..246 CDD:275368 3/20 (15%)
C2H2 Zn finger 254..274 CDD:275368 4/20 (20%)
C2H2 Zn finger 282..302 CDD:275368 5/21 (24%)
C2H2 Zn finger 310..330 CDD:275368 5/20 (25%)
C2H2 Zn finger 338..358 CDD:275368 1/20 (5%)
C2H2 Zn finger 366..386 CDD:275368 5/23 (22%)
C2H2 Zn finger 394..414 CDD:275368 6/20 (30%)
C2H2 Zn finger 422..442 CDD:275368 6/20 (30%)
C2H2 Zn finger 450..470 CDD:275368 8/20 (40%)
C2H2 Zn finger 478..498 CDD:275368 9/21 (43%)
C2H2 Zn finger 506..526 CDD:275368 6/20 (30%)
C2H2 Zn finger 534..554 CDD:275368 0/20 (0%)
C2H2 Zn finger 562..582 CDD:275368 7/18 (39%)
C2H2 Zn finger 590..610 CDD:275368
C2H2 Zn finger 618..638 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.