DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb3

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001091707.1 Gene:Zbtb3 MGIID:1922541 Length:518 Species:Mus musculus

Alignment Length:458 Identity:84/459 (18%)
Similarity:135/459 (29%) Gaps:166/459 (36%)


  Fly   144 AAEMHK----RLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRK 204
            |:.:|.    ::.|.||:.||                     |||      .|..:.|  |:...
Mouse   103 ASYLHMNDIVKVCKQRLQARA---------------------LAE------ADSTKKE--EETNP 138

  Fly   205 EQLAMLLGELE----VYLTEKKAGRWES--------------------LDGSEPETKPQVKEDAS 245
            ..|..|.|...    :..:.:.:.||..                    :.|....|:|.::.|:|
Mouse   139 ASLEFLSGSSRGPQPLLASVEPSARWNKEEWKGPATPLPIAHPADEPPVSGGADTTQPSMEVDSS 203

  Fly   246 PSRSKTKALPKRRPSLVDANL------KATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEE 304
            ..|:..       |.:.|.::      .:||..........:.|.:.:|....||..:.|.:.| 
Mouse   204 HLRAPP-------PPVADVSVSLASPSSSTETIPVNYFSSGLPGVSVEPLTPLDVVPESLRVVE- 260

  Fly   305 VPAESGEDFR------------------------EINMVGSDVVHTDNGEIYIINSASSEDQNQD 345
             |.::|...:                        |..:|...|      |..:|:          
Mouse   261 -PRDTGGPLQGFYPPAPAPPPAPAPVLSQAPAPVEAELVQVKV------EAIVIS---------- 308

  Fly   346 STPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEI--SQEQQVFSFHENVIIVEKE 408
                              |.|...|.|:|...|.  :|..|..:  .|..|..:|.|        
Mouse   309 ------------------DEEADLSEEQPHRSEG--LFPPGGAVYGGQPSQAEAFEE-------- 345

  Fly   409 QNDRDEQTPLKRKRSSELVFKQESSCPQ---PKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNT 470
                ...|.|:....|:.....||..|.   |..|         |.|...|..|.......|...
Mouse   346 ----PGATGLEEVGPSDHFLPPESHLPYHLLPGPG---------QYHRGLVTSPLPAPAALHEPL 397

  Fly   471 HIKGLKSGKGGTL--------KCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLK 527
            :.........|:.        .|.:|....||:.:|:||..:||..:|::|..|..|::|...|.
Mouse   398 YPPPEYEAAQGSFGNFTEDVPTCKTCGKTFSCSYTLRRHATVHTRERPYECRYCLRSYTQSGDLY 462

  Fly   528 RHM 530
            ||:
Mouse   463 RHI 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 22/128 (17%)
RRF <161..222 CDD:294170 9/65 (14%)
zf-C2H2_8 454..530 CDD:292531 21/84 (25%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 3/6 (50%)
C2H2 Zn finger 541..562 CDD:275368
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Zbtb3NP_001091707.1 BTB 14..120 CDD:279045 5/17 (29%)
BTB 25..119 CDD:197585 4/16 (25%)
COG5048 <418..493 CDD:227381 17/49 (35%)
C2H2 Zn finger 420..440 CDD:275368 7/20 (35%)
zf-H2C2_2 433..457 CDD:290200 9/24 (38%)
C2H2 Zn finger 448..466 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.