DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb49

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_083438.1 Gene:Zbtb49 MGIID:1922329 Length:756 Species:Mus musculus

Alignment Length:434 Identity:109/435 (25%)
Similarity:165/435 (38%) Gaps:89/435 (20%)


  Fly   227 ESLDGSEPE----------------TKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDA 275
            ::..||.||                :|...|:.|.||:......|..|.:..|  |.|.:::...
Mouse   191 DAAGGSCPELPCKQPNHYYKLRTLYSKQYYKQTACPSQVPATQQPLTRSASTD--LAAADSQPPV 253

  Fly   276 KEEEFILGCN--------TDPANNS--DVNIDGLELDEEVPA-----ESGEDFREINMVGSDVVH 325
            :....:|...        ..|..||  |...|.|   .|.||     :.....:::|.:.|    
Mouse   254 EGRPAVLETPEHLPSTFVAPPVRNSGNDSEADPL---SEPPAKQMRLKKAMHLKKLNFLKS---- 311

  Fly   326 TDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYN---IKEDGEIQFSGEKPEEIEDVVVFNLGE 387
                           .|:.:.|...:.|||:....   .|||. ::.:|.  :..|:.....||.
Mouse   312 ---------------QQSAECTSHPEPDNGLARREESAAKEDA-VERAGS--QTAEEKGRGELGP 358

  Fly   388 EISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELV---FKQESSCPQPK---TGRITDTV 446
            |.|:|:::..       ......|..:....:::.:.||.   ||..|:....|   ||.     
Mouse   359 ESSREEELPG-------APASWEDPSQALQPQKQYACELCGKPFKHPSNLELHKRSHTGE----- 411

  Fly   447 KSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPF 511
            |.|:|::|...|.....|..|...|     ||:...: |..|..:.:.:..::||:|||:|.||.
Mouse   412 KPFECNICGKHFSQAGNLQTHLRRH-----SGEKPYI-CEICGKRFAASGDVQRHIIIHSGEKPH 470

  Fly   512 KCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHR 576
            .|..|...||....||.|..|||..|...|.:|...|..:..|.:|  ||.....|.:.|..|.:
Mouse   471 LCDTCGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKH--RVRHTGERPYSCPACGK 533

  Fly   577 SFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMH 619
            .|.....|.||:.||.|.. :||:.|.:.|. ||||.|....||
Mouse   534 CFGGSGDLRRHVRTHTGEKPYSCEVCSKCFT-RSAVLRRHKRMH 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 6/33 (18%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 24/76 (32%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 8/19 (42%)
Zbtb49NP_083438.1 BTB 15..118 CDD:279045
BTB 26..119 CDD:197585
COG5048 <376..576 CDD:227381 66/214 (31%)
zf-C2H2 386..408 CDD:278523 6/22 (27%)
C2H2 Zn finger 388..408 CDD:275368 6/20 (30%)
zf-H2C2_2 400..425 CDD:290200 8/30 (27%)
C2H2 Zn finger 416..436 CDD:275368 5/20 (25%)
zf-H2C2_2 428..452 CDD:290200 7/30 (23%)
C2H2 Zn finger 444..464 CDD:275368 6/20 (30%)
zf-H2C2_2 456..481 CDD:290200 12/25 (48%)
C2H2 Zn finger 472..492 CDD:275368 8/20 (40%)
zf-H2C2_2 484..508 CDD:290200 10/24 (42%)
C2H2 Zn finger 500..520 CDD:275368 7/22 (32%)
zf-H2C2_2 513..535 CDD:290200 7/24 (29%)
C2H2 Zn finger 528..548 CDD:275368 7/20 (35%)
zf-H2C2_2 540..565 CDD:290200 10/26 (38%)
C2H2 Zn finger 556..576 CDD:275368 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.