DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb11

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_012813021.1 Gene:zbtb11 XenbaseID:XB-GENE-988913 Length:1109 Species:Xenopus tropicalis

Alignment Length:604 Identity:126/605 (21%)
Similarity:228/605 (38%) Gaps:163/605 (27%)


  Fly   142 EQAAEMHKRLVKSRLELRAKLTTELRKEL-------AEEVRSEVRKELAEEVRSQVRDDLRNE-- 197
            |....:||::..:::.|..|:.......|       .:.|.:...:.|||.:.||....:.||  
 Frog   292 EICESVHKQMETNQINLCQKVDVVSENGLLDGRVVKLQAVGNNAPQLLAEVINSQKTSLVNNENV 356

  Fly   198 -----------------VSEDIRKE----------QLAMLLGELEVYLTEKKAGRWES------L 229
                             :|:...:.          .::.|.|...:||::..:....:      :
 Frog   357 ECEAAATETVTNSTDGAISQSSEESTVQLVTSPEIPISSLTGTTAIYLSDVSSELQPAVIIPAVI 421

  Fly   230 DGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDV 294
            |.|..:...|:..| :|..|.|...|:.:.|...:|:       |..:|...:.|.|        
 Frog   422 DVSNVQEHQQILGD-TPEDSTTAEHPESQQSTAGSNM-------DVPDEVLSVTCTT-------- 470

  Fly   295 NIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDN----- 354
                  .:|::||:..:. ::::|.            .:|||:::.|. |.|.|..::.:     
 Frog   471 ------TEEKLPADDPQP-KDVSMK------------ELINSSTNGDP-QVSVPVAEESSISVID 515

  Fly   355 -------GITSYNIKEDGEIQFSGE-----------KPEEIE----------------------- 378
                   .:...|...|.|.:. ||           .||::|                       
 Frog   516 LETTCAEDVVIGNTDPDPEAKI-GEVPKRKRGRPRKSPEDVEKSCKETRETLPSGGKCTYKGKLR 579

  Fly   379 -------DVVVFNLGEEISQEQQVFSFHENV--IIVEKEQNDRDEQTPLKRKRSSELVFKQESSC 434
                   ..::.:.|:|.:.:::..:....|  ..::..|..:.::..:.:|:.:|..||. :.|
 Frog   580 DCLVGKGGYIMLHRGQEKALKKRKANPKSAVQQAAMKLLQRGKKKRLMVPKKQIAEAQFKC-NDC 643

  Fly   435 P---QPKTGRITDTV-----KSFQCHLCPVAFPTQKLLTRHHNTHIKGLK-----------SGKG 480
            .   |.:...|..:|     |.|:|.||...|..:..|..|...|.|..|           :.||
 Frog   644 GMMFQRRYALIMHSVKHEKSKEFKCPLCTKEFQYRASLRAHLIRHSKTGKAEVNVVETEADTAKG 708

  Fly   481 GTLK---CPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCP 542
            ||.:   |..|...|....||:.||:.|||:||..|..|..:|:.:..||.|...|...|:.:|.
 Frog   709 GTKRQFICGICGRTLPKLYSLRIHMLKHTGVKPHACEVCGKTFTHKHGLKMHQALHESHKQFKCD 773

  Fly   543 QCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM----FSCKQCGR 603
            .|...|....:||:|:. .|.|.|: :.|.:|.::|:..||||:||..|...:    :.|.||.:
 Frog   774 MCEKSFVTNRSLQEHVS-THTGESK-YLCSVCGKAFHRASGLSKHLKKHKPKVETRGYHCTQCEK 836

  Fly   604 QFNDRSAVQRHVTTMHKVK 622
            .|.:...:|:|:.....||
 Frog   837 SFFELRDLQQHMNKHLGVK 855

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 23/144 (16%)
RRF <161..222 CDD:294170 15/97 (15%)
zf-C2H2_8 454..530 CDD:292531 29/90 (32%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 8/24 (33%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 9/20 (45%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
zbtb11XP_012813021.1 BTB 194..295 CDD:279045 1/3 (33%)
BTB 205..296 CDD:197585 1/4 (25%)
C2H2 Zn finger 640..660 CDD:275368 4/21 (19%)
C2H2 Zn finger 668..688 CDD:275368 6/20 (30%)
C2H2 Zn finger 716..736 CDD:275368 7/20 (35%)
zf-H2C2_2 728..753 CDD:290200 12/25 (48%)
C2H2 Zn finger 744..764 CDD:275368 6/20 (30%)
C2H2 Zn finger 772..792 CDD:275368 6/21 (29%)
zf-H2C2_2 784..809 CDD:290200 9/27 (33%)
C2H2 Zn finger 800..820 CDD:275368 9/20 (45%)
C2H2 Zn finger 831..851 CDD:275368 6/20 (30%)
zf-H2C2_2 843..867 CDD:290200 4/14 (29%)
C2H2 Zn finger 859..879 CDD:275368
C2H2 Zn finger 887..909 CDD:275370
C2H2 Zn finger 923..943 CDD:275368
C2H2 Zn finger 951..971 CDD:275368
zf-H2C2_2 963..986 CDD:290200
C2H2 Zn finger 979..1000 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.