DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZBTB8B

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001139192.1 Gene:ZBTB8B HGNCID:37057 Length:495 Species:Homo sapiens

Alignment Length:244 Identity:58/245 (24%)
Similarity:97/245 (40%) Gaps:62/245 (25%)


  Fly   374 PEEIEDVVVFNLGE---EISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCP 435
            |:.||..|.|:..|   ::.::.|.::...|:..||       |..|                  
Human   224 PKRIEPKVEFDADEVEVDVGEQLQQYAAPLNLAHVE-------EALP------------------ 263

  Fly   436 QPKTGRITDT------VKSF-QCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLS 493
               :|:..|.      ||.| :..|...|.|::.....|.:..::|...|.|         :.:|
Human   264 ---SGQAVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAG---------VAMS 316

  Fly   494 CASSLKRHM-------IIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQK 551
            ....::...       ::...:|..||..|..:..|:.:||||:.:|||.:.:.|..|...|.::
Human   317 SMMDVQADWYGEDSGDVLVVPIKLHKCPFCPYTAKQKGILKRHIRSHTGERPYPCETCGKRFTRQ 381

  Fly   552 SNLQQHIGRVHMGNSRTHKCHLCHRSF-NHVS-GLSRHLVTHAGVMFSC 598
            .:|:.|...||..| |...|..|.|:| :|:| ||.|.     |:..||
Human   382 EHLRSHALSVHRSN-RPIICKGCRRTFTSHLSQGLRRF-----GLCDSC 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 16/83 (19%)
C2H2 Zn finger 485..505 CDD:275368 1/27 (4%)
zf-H2C2_2 497..522 CDD:290200 4/32 (13%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 9/22 (41%)
C2H2 Zn finger 598..617 CDD:275368 1/2 (50%)
ZBTB8BNP_001139192.1 BTB 14..118 CDD:279045
BTB 25..122 CDD:197585
C2H2 Zn finger 343..363 CDD:275368 7/20 (35%)
zf-H2C2_2 356..380 CDD:290200 10/24 (42%)
C2H2 Zn finger 371..392 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.