DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp131

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001289476.1 Gene:Zfp131 MGIID:1919715 Length:619 Species:Mus musculus

Alignment Length:552 Identity:105/553 (19%)
Similarity:205/553 (37%) Gaps:141/553 (25%)


  Fly   112 LEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEM-------HKRLVKSRLELRAKLTTELRKE 169
            :|.|:::..::...:..|:..::..|..::::..::       |.:..|:.|...:|...:..:|
Mouse     1 MEAEETMECLQEFPEHHKMILDRLNEQREQDRFTDITLIVDGHHFKAHKAVLAACSKFFYKFFQE 65

  Fly   170 LAEEVRSEVRK----------ELAEEVRSQVRDDLRNEVSEDIRK--EQLAML--LGELEVYLTE 220
            ..:|...|:..          |.....:..::.:   |.:.|:.|  |.|.||  :..|||...|
Mouse    66 FTQEPLVEIEGVSKMAFRHLIEFTYTAKLMIQGE---EEANDVWKAAEFLQMLEAIKALEVRNKE 127

  Fly   221 KKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCN 285
            ..|...|:..|.....|.::   |..|...|::||......|:..::..|...:.::|       
Mouse   128 NSAPLEENTTGKNEAKKRKI---AETSNVITESLPSAESEPVEIEVEIAEGTIEVEDE------- 182

  Fly   286 TDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEF 350
                        |:|..||: |.:.:..:.|...||    :|:..:.::...:|:.:..:|..:.
Mouse   183 ------------GIEALEEM-ASAKQSIKYIQSTGS----SDDSALALLADITSKYRQGESKGQI 230

  Fly   351 DQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQ 415
            .:|:..             |....:::|.:.:..|  ::|..:.:|...                
Mouse   231 SEDDCA-------------SDPISKQVEGIEIVEL--QLSHVKDLFHCE---------------- 264

  Fly   416 TPLKRKRSSELV--FKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNT-HIKGLKS 477
               |..||.:|.  ||:...         :.:.:||:|.:|...:..:....:|.|. |::    
Mouse   265 ---KCNRSFKLFYHFKEHMK---------SHSTESFKCEICNKRYLRESAWKQHLNCYHLE---- 313

  Fly   478 GKGGTLK----------CPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHM-- 530
             :||..|          |..|..|.......|.|:..|||.|||:||.|...|::...||.|:  
Mouse   314 -EGGVSKKQRTGKKIHICQYCDKQFDHFGHFKEHLRKHTGEKPFECSNCHERFARNSTLKCHLTA 377

  Fly   531 -DTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGV 594
             .|..|.|:                         |..:.::|.:|:..||.......|||.|.|.
Mouse   378 CQTGVGAKK-------------------------GRKKLYECQVCNSVFNSWDQFKDHLVIHTGD 417

  Fly   595 MFS-CKQCGRQFNDRSAVQRHVTTMHKVKNKL 625
            ..: |..|...|...:.::||::..|.:..::
Mouse   418 KPNHCTLCDLWFMQGNELRRHLSDAHNISERI 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 27/153 (18%)
RRF <161..222 CDD:294170 16/75 (21%)
zf-C2H2_8 454..530 CDD:292531 25/87 (29%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 8/23 (35%)
zf-H2C2_2 526..550 CDD:290200 6/27 (22%)
C2H2 Zn finger 541..562 CDD:275368 0/21 (0%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
Zfp131NP_001289476.1 BTB 24..122 CDD:279045 17/101 (17%)
BTB 35..122 CDD:197585 16/90 (18%)
Nuclear localization signal 1. {ECO:0000250} 137..148 2/14 (14%)
COG5048 <262..444 CDD:227381 53/240 (22%)
C2H2 Zn finger 263..283 CDD:275368 6/48 (13%)
C2H2 Zn finger 290..311 CDD:275368 4/21 (19%)
Nuclear localization signal 2. {ECO:0000250} 317..328 1/11 (9%)
C2H2 Zn finger 330..350 CDD:275368 5/20 (25%)
zf-H2C2_2 342..367 CDD:290200 12/25 (48%)
C2H2 Zn finger 358..375 CDD:275368 7/17 (41%)
C2H2 Zn finger 394..414 CDD:275368 7/20 (35%)
C2H2 Zn finger 422..439 CDD:275370 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.