DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zbtb18

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006250390.1 Gene:Zbtb18 RGDID:621548 Length:531 Species:Rattus norvegicus

Alignment Length:479 Identity:113/480 (24%)
Similarity:197/480 (41%) Gaps:98/480 (20%)


  Fly   109 EDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHK-RLVK-SRLELRAKLTTELRKELA 171
            |.:|:|:|    :.::|.:              ..|:.:|. .:|| .:.:|:.|.|||......
  Rat    93 EGKLQFKD----LPIEDVL--------------AAASYLHMYDIVKVCKKKLKEKATTEADSTKK 139

  Fly   172 EEVRSEV--RKELAEEVRSQVRDDLRN--EVSEDIR------KEQLAMLLGELEVYLTEKKAGRW 226
            ||..|..  :.|...:..|.:..||.:  :..||.:      |..||...|.:.:.|....||..
  Rat   140 EEDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDDKLNILPSKRDLAAEPGNMWMRLPSDAAGIP 204

  Fly   227 ESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANN 291
            ::...:||......|..|||. |.|::|.:|..:.|          :|:.:.:.:|..:...:.:
  Rat   205 QAGGEAEPHATAAGKTVASPC-SSTESLSQRSVTSV----------RDSADVDCVLDLSVKSSLS 258

  Fly   292 SDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGI 356
            ...|::....       |.:|....|:|          ::.:...||. |::...|.::|.::..
  Rat   259 GVENLNSSYF-------SSQDVLRSNLV----------QVKVEKEASC-DESDVGTNDYDMEHST 305

  Fly   357 TSYNIKEDGEIQFSGEKPEEI----EDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTP 417
            ...::..:..:|:   :|..:    ||.|:    .|:.:|.:.              :|.:..||
  Rat   306 VKESVSANNRVQY---EPAHLAPLREDSVL----RELDREDKA--------------SDDEMMTP 349

  Fly   418 LKRKRSSELVFKQ---ESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIK---GLK 476
                 .||.|..:   |||.....:..::...:.|.|.||...||:..:|..|.:||.:   |::
  Rat   350 -----ESERVQVEGGMESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIR 409

  Fly   477 SGKGGTLKCPSCAL---QLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKR 538
            |.....:..|:|:|   ..||..:||||...|:|.||:.|::|..||.....|.||...||..|.
  Rat   410 SKPAADVNVPTCSLCGKTFSCMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKP 474

  Fly   539 HQCPQCSSCFAQKSNLQQHIGRVH 562
            |.|..|...|.|..:|.:||.:.|
  Rat   475 HACKWCERRFTQSGDLYRHIRKFH 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 33/147 (22%)
RRF <161..222 CDD:294170 18/71 (25%)
zf-C2H2_8 454..530 CDD:292531 29/82 (35%)
C2H2 Zn finger 485..505 CDD:275368 9/23 (39%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Zbtb18XP_006250390.1 BTB 23..119 CDD:279045 7/44 (16%)
BTB 34..119 CDD:197585 7/44 (16%)
COG5048 <360..>490 CDD:227381 43/130 (33%)
C2H2 Zn finger 381..401 CDD:275368 8/20 (40%)
C2H2 Zn finger 421..441 CDD:275368 8/20 (40%)
zf-H2C2_2 434..456 CDD:290200 11/22 (50%)
C2H2 Zn finger 449..469 CDD:275368 7/20 (35%)
C2H2 Zn finger 477..495 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.