DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp970

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001171039.1 Gene:Zfp970 MGIID:3652255 Length:522 Species:Mus musculus

Alignment Length:373 Identity:95/374 (25%)
Similarity:152/374 (41%) Gaps:59/374 (16%)


  Fly   270 EARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDV----------- 323
            |.|..|::....:.|....|..|       .....|...:||...|.|..|.|.           
Mouse    66 ERRSSAEQHSEFIQCGKAFACQS-------HSQRHVRIHNGEKHYECNQCGKDFGTRSVLQRLKR 123

  Fly   324 VHTDN--------GEIYIINSASSEDQNQDSTPE-FDQDNGITSYNIKEDGEIQ---FSGEKPEE 376
            .||..        |:.:..:|.....:.:.:..| ::.::.:.::..:.|.:|.   .:||||.|
Mouse   124 THTGEKPYECNHCGKAFAESSTLQIHKRKHTGDEPYECNHCVKAFAKRSDLQIHKRIHTGEKPYE 188

  Fly   377 IEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGR 441
            ..     ..|:..::...: ..|:.....||         |.:.|:..: .|.:.|:.   :|.:
Mouse   189 CN-----QCGKAFTRSSHL-GIHKRTHTGEK---------PYECKQCGK-AFARSSTL---QTHK 234

  Fly   442 ITDT-VKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIH 505
            .|.| .|.::|..|..||.....|..|..||.      .....:|..|....:.:|:|:.|...|
Mouse   235 HTHTGEKPYECKQCGKAFAQSGPLQIHKRTHT------AEKPYECKQCGKAFAHSSTLQIHKRTH 293

  Fly   506 TGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHK 570
            ||.||::|.:|:.:|.:|..|:.|..||||.|.::|.||...|||...||:| .|.|.| .:..:
Mouse   294 TGEKPYECKQCDKAFVKRGELQIHKRTHTGEKPYECKQCGKAFAQSGTLQEH-ERTHTG-EKPFE 356

  Fly   571 CHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTT 617
            |:.|.::|.....|..|..||.|.. :.|||||:.|.....:|.|..|
Mouse   357 CNQCGKAFVRCIALRIHERTHTGEKPYECKQCGKAFAQSGTLQGHERT 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 23/76 (30%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 10/21 (48%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 8/19 (42%)
Zfp970NP_001171039.1 KRAB 4..>45 CDD:214630
KRAB 4..43 CDD:279668
COG5048 75..477 CDD:227381 92/365 (25%)
C2H2 Zn finger 79..97 CDD:275368 4/25 (16%)
C2H2 Zn finger 105..125 CDD:275368 3/20 (15%)
C2H2 Zn finger 133..153 CDD:275368 2/20 (10%)
C2H2 Zn finger 161..181 CDD:275368 2/20 (10%)
zf-H2C2_2 173..198 CDD:290200 8/30 (27%)
C2H2 Zn finger 189..209 CDD:275368 2/26 (8%)
zf-H2C2_2 201..226 CDD:290200 6/36 (17%)
C2H2 Zn finger 217..237 CDD:275368 5/24 (21%)
zf-H2C2_2 230..254 CDD:290200 8/27 (30%)
C2H2 Zn finger 245..265 CDD:275368 7/20 (35%)
zf-H2C2_2 258..282 CDD:290200 6/30 (20%)
C2H2 Zn finger 273..293 CDD:275368 5/20 (25%)
zf-H2C2_2 286..309 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 7/20 (35%)
zf-H2C2_2 313..338 CDD:290200 12/25 (48%)
C2H2 Zn finger 329..349 CDD:275368 10/21 (48%)
zf-H2C2_2 342..366 CDD:290200 9/26 (35%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
zf-H2C2_2 369..394 CDD:290200 11/25 (44%)
C2H2 Zn finger 385..405 CDD:275368 9/21 (43%)
zf-H2C2_2 398..422 CDD:290200 3/8 (38%)
C2H2 Zn finger 413..433 CDD:275368
zf-H2C2_2 425..450 CDD:290200
C2H2 Zn finger 441..461 CDD:275368
zf-H2C2_2 454..478 CDD:290200
COG5048 465..>522 CDD:227381
C2H2 Zn finger 469..489 CDD:275368
zf-H2C2_2 482..506 CDD:290200
C2H2 Zn finger 497..517 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.