DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZNF624

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_065838.2 Gene:ZNF624 HGNCID:29254 Length:865 Species:Homo sapiens

Alignment Length:478 Identity:113/479 (24%)
Similarity:177/479 (37%) Gaps:146/479 (30%)


  Fly   235 ETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGL 299
            |.||:.:..|:...|..:..|:......|.:|:|.|.:...:...|           .||.|| .
Human    11 EGKPEGEIMAAVFFSVGRLSPEVTQPDEDLHLQAEETQLVKESVTF-----------KDVAID-F 63

  Fly   300 ELDE---EVPAESG-------EDFREINMVG-----SDVV-HTDNG--------EIYII------ 334
            .|:|   ..|.:..       |::|.:..:|     .|:: |.:||        ||..|      
Human    64 TLEEWRLMDPTQRNLHKDVMLENYRNLVSLGLAVSKPDMISHLENGKGPWVTVREISRIPYPDME 128

  Fly   335 ----------NSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEI 389
                      ..|.|||.:|::..|...:||:..                               
Human   129 PKPATKKATRTKAISEDLSQEAILEKLTENGLWD------------------------------- 162

  Fly   390 SQEQQVFSFHENVIIVEKEQNDRDEQ--TPLKRKRSSELVFKQES-SCPQP-------------- 437
            |:.:.::.:::.::.::..|.:...|  .|||:..:|:..|:.|| ..|:|              
Human   163 SRMEGLWKWNDRILRLQNNQENHLSQRIIPLKKTPTSQRGFRFESILIPEPGIATEELHSRCQTQ 227

  Fly   438 ------KTGRITDT-------------------------------VKSFQCHLCPVAFPTQKLLT 465
                  ....||||                               .|.::|..|..||..:.||.
Human   228 EENFTENLNLITDTHLGKIICKEMKGSKAIRQTSELTLGKKSNNKEKPYKCSTCEKAFHYRSLLI 292

  Fly   466 RHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHM 530
            :|..||.      |....:|..|....|..|.|.:|..||||.||:||:||..:|.....|..|.
Human   293 QHQRTHT------KEKPYECNECGKTFSQPSYLSQHKKIHTGEKPYKCNECGKAFIASSSLMVHQ 351

  Fly   531 DTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM 595
            ..||..|.:||..|...|:|.:.|.|| .|:..| .:.:||..|.::|:..|.|:||..||.|..
Human   352 RIHTKEKPYQCNVCGKSFSQCARLNQH-QRIQTG-EKPYKCSECGKAFSDKSKLARHQETHNGEK 414

  Fly   596 -FSCKQCGRQFNDRSAVQRHVTT 617
             :.|..||:.|.::|.:..|..|
Human   415 PYKCDDCGKAFRNKSYLSVHQKT 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 3/9 (33%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 28/76 (37%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
ZNF624NP_065838.2 KRAB 54..114 CDD:214630 15/72 (21%)
KRAB 54..93 CDD:279668 10/51 (20%)
C2H2 Zn finger 254..270 CDD:275368 0/16 (0%)
COG5048 <268..463 CDD:227381 61/179 (34%)
C2H2 Zn finger 278..298 CDD:275368 8/20 (40%)
zf-H2C2_2 291..315 CDD:290200 8/30 (27%)
C2H2 Zn finger 306..326 CDD:275368 7/20 (35%)
zf-H2C2_2 318..341 CDD:290200 12/23 (52%)
C2H2 Zn finger 334..354 CDD:275368 6/20 (30%)
zf-H2C2_2 346..371 CDD:290200 9/25 (36%)
C2H2 Zn finger 362..381 CDD:275368 8/20 (40%)
zf-H2C2_2 375..398 CDD:290200 9/25 (36%)
zf-C2H2 388..410 CDD:278523 9/22 (41%)
C2H2 Zn finger 390..410 CDD:275368 8/20 (40%)
zf-H2C2_2 403..427 CDD:290200 10/24 (42%)
COG5048 414..826 CDD:227381 7/25 (28%)
C2H2 Zn finger 418..438 CDD:275368 7/21 (33%)
zf-H2C2_2 430..455 CDD:290200 2/9 (22%)
C2H2 Zn finger 446..466 CDD:275368
zf-H2C2_2 459..483 CDD:290200
C2H2 Zn finger 474..494 CDD:275368
zf-H2C2_2 486..511 CDD:290200
C2H2 Zn finger 502..522 CDD:275368
zf-H2C2_2 514..537 CDD:290200
C2H2 Zn finger 530..550 CDD:275368
zf-H2C2_2 543..565 CDD:290200
C2H2 Zn finger 558..578 CDD:275368
C2H2 Zn finger 586..606 CDD:275368
zf-H2C2_2 598..622 CDD:290200
C2H2 Zn finger 614..634 CDD:275368
zf-H2C2_2 626..651 CDD:290200
C2H2 Zn finger 642..662 CDD:275368
zf-H2C2_2 654..679 CDD:290200
C2H2 Zn finger 670..690 CDD:275368
zf-H2C2_2 683..707 CDD:290200
C2H2 Zn finger 698..718 CDD:275368
zf-H2C2_2 711..735 CDD:290200
C2H2 Zn finger 726..746 CDD:275368
zf-H2C2_2 738..763 CDD:290200
C2H2 Zn finger 754..774 CDD:275368
C2H2 Zn finger 782..802 CDD:275368
zf-H2C2_2 795..819 CDD:290200
C2H2 Zn finger 810..830 CDD:275368
zf-H2C2_2 822..847 CDD:290200
C2H2 Zn finger 838..858 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.