DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb46

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_021325589.1 Gene:zbtb46 ZFINID:ZDB-GENE-090313-352 Length:703 Species:Danio rerio

Alignment Length:649 Identity:128/650 (20%)
Similarity:201/650 (31%) Gaps:225/650 (35%)


  Fly   141 EEQAAEMHKRLV-------------KSRLELRAKLTTELRK--------ELAEEVRSEVRKELAE 184
            |:||...|..:|             .:.|.|.:|...|:..        ::.:.....::..|..
Zfish    68 EQQATITHLDIVTAQGFKTILDFMYSAHLALTSKNVIEVMSAASYLQMTDIVQACHGFIKAALDI 132

  Fly   185 EVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDG--SEPETKPQVKEDASPS 247
            .:||::.|:|     .||....:...:|...|   ....|..|:|..  |...:.|.:....||:
Zfish   133 SIRSELADEL-----ADIEMGNVVSSIGGGAV---PGVGGASEALASMISARSSSPWLARRTSPA 189

  Fly   248 RS-----------------KTKALPKRRPSLVDANLK----ATEARKDAKEEEFILGCNTDPANN 291
            .|                 |....||...|..||.|:    |.......|||:      ..|:|.
Zfish   190 NSSGDSAIASCHEGSSNYGKEDQEPKSHESQEDACLQPLWPADYRSVQVKEEQ------VSPSNL 248

  Fly   292 SD---VNIDGLELDEEVPAESG----EDFREINMVGSDVV----HTDNGEIYIINSASSEDQNQD 345
            .|   ..:.|...|:....|.|    ...|..|....|.|    ..:.|:    :..:|...:..
Zfish   249 QDGAGRGVQGTPGDQGGRGEGGWQPPGSGRRKNRKNKDTVRHITQQNEGD----SRTASPLPSML 309

  Fly   346 STPEFDQDN------GITSYNIKED----------------GEIQF-SGEKPEEIEDV---VVFN 384
            |||.::..|      .:|..||.:.                |:..| |||:.|.:...   .|.|
Zfish   310 STPGWNYSNQDIPGAEVTEPNISDSRSERMDLLVKQEEATAGDSGFLSGERDEAVAQERAGSVAN 374

  Fly   385 LGEEISQEQQVFSFHENVIIVEKEQNDRDEQTP------------LKRKRSSE---------LVF 428
            |...:..:..:.|....::         .|:.|            |.|.|.|.         .:|
Zfish   375 LRAALMSKNSLLSLGAEML---------GEENPLLFDYLPKGGHSLSRPRCSNGSSSSHHPGGLF 430

  Fly   429 KQE----SSCP-------------------------QPKTGRITDTVKSFQCHLCPVAFPTQ--- 461
            ..:    ||.|                         .|::|...|.:.:.|   .|.|.||:   
Zfish   431 GSKHGASSSSPPSTLPPLPLLLPPPPSMLQPPGAHYMPQSGGPPDKLYAEQ---APKASPTEEEM 492

  Fly   462 -----------------------KLLTRHHNTHIKGLKSGKGG---TLKCPSCALQLSCASSLKR 500
                                   :::...|...:..::.|..|   .|.|..|....|....|::
Zfish   493 QEEDNSPNNNAELERIQVPVEEDQMVEEKHGVCVAEVQGGGPGWRQELACSLCKQLFSSLLQLRQ 557

  Fly   501 HMIIHT----------------------GLKP----FKCSECELSFSQREVLKRHMDT-HTGVKR 538
            |...||                      .|.|    :.||:|..||:.:....||..| |...|.
Zfish   558 HEYSHTLSLMALSLDCLDHHRPLVASASPLNPQPARYHCSQCPASFTLKSNADRHEKTIHLKRKL 622

  Fly   539 HQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQCG 602
            .||..|...|..:::|.:|:..|| .:.|.:.|..|.|:|:    ..::|.||..|   |.|.|
Zfish   623 MQCVYCLKHFRDRTDLNRHLSSVH-SSERVYTCPACSRTFS----TQKNLATHGKV---CCQSG 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 23/126 (18%)
RRF <161..222 CDD:294170 11/69 (16%)
zf-C2H2_8 454..530 CDD:292531 24/131 (18%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 11/51 (22%)
C2H2 Zn finger 513..533 CDD:275368 8/21 (38%)
zf-H2C2_2 526..550 CDD:290200 9/25 (36%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 3/6 (50%)
zbtb46XP_021325589.1 BTB 21..127 CDD:306997 9/59 (15%)
C2H2 Zn finger 542..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 596..617 CDD:275368 8/21 (38%)
C2H2 Zn finger 625..646 CDD:275368 6/21 (29%)
C2H2 Zn finger 654..670 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.