DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb7a

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_005170586.1 Gene:zbtb7a ZFINID:ZDB-GENE-050208-583 Length:617 Species:Danio rerio

Alignment Length:463 Identity:107/464 (23%)
Similarity:170/464 (37%) Gaps:137/464 (30%)


  Fly   202 IRKEQLAMLLG-ELEVYLTEKKAGRWESLDGSEP-ETKPQVKEDASPSRSKTKALPKRRPSLVDA 264
            :|.|.||.||. .....||..:....:.|..:.. |..|  .:|.......||.|.....:..:.
Zfish   127 VRPEALAALLDFAYTATLTVSRNSVVDILSAAHVLEISP--VQDVCTHLLDTKVLSPPAGNEQED 189

  Fly   265 NLKATEARKDAKEE----------EFI-------LGCNTD-----PA-------NNSDVNIDGLE 300
            |.:..|..|:.||:          ||.       ..|:|.     ||       |.:|.|  |:.
Zfish   190 NEEEEERGKNGKEQGIRLRAREYLEFFQRGAHWGSSCSTPELRDLPAHLHFSQRNGADRN--GIP 252

  Fly   301 L---------------------DEEVPAESGEDFREINMVGSDVV----HTDNGEIYIINSASSE 340
            :                     ||.|..||.:..|....|...::    .|.||..|:       
Zfish   253 IGPADYYSPLAQALSQPPRDPEDENVDEESQDVARAREKVAEGLMPFFAPTQNGHYYL------- 310

  Fly   341 DQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIV 405
               ..:.|             |.:.|::.:|::..        |.|...:..||:....|.    
Zfish   311 ---HQADP-------------KSEREVEVTGDREH--------NQGPASALLQQMMDSLER---- 347

  Fly   406 EKEQNDR----DEQTPLKRKRSSELVFKQESSCPQ-PKTGRITDTVKSFQCHLCPVAFPTQKLLT 465
            ::|:...    ::..|...:...|...|..|:.|: |.:..|:.:       |.|: :|      
Zfish   348 KRERGTTGGGGEDDGPEGDEPDVEFYLKYFSAQPEGPTSAPISPS-------LAPL-WP------ 398

  Fly   466 RHHNTHIKGLKSGKGGT---------------LKCPSCALQLSCASSLKRHMIIHTGLKPFKCSE 515
                  ::|...|...|               .|||.|:..:..|..|.||:..|||.||::|:.
Zfish   399 ------VRGNGGGNQATGGGNSGERKMRSKAFQKCPICSKVIQGAGKLPRHIRTHTGEKPYECAI 457

  Fly   516 CELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNH 580
            |::.|::::.||.||..|||.|.:.|.||.:.||...:|:.|: |||.| .|.::|..|.::|..
Zfish   458 CKVRFTRQDKLKVHMRKHTGEKPYLCTQCGAAFAHNYDLKNHM-RVHTG-LRPYQCSSCFKTFVR 520

  Fly   581 VSGLSRHL 588
            ...|.|||
Zfish   521 SDHLHRHL 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 12/44 (27%)
RRF <161..222 CDD:294170 8/21 (38%)
zf-C2H2_8 454..530 CDD:292531 24/91 (26%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 13/24 (54%)
C2H2 Zn finger 541..562 CDD:275368 9/21 (43%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..617 CDD:275368
zbtb7aXP_005170586.1 BTB 71..175 CDD:279045 12/50 (24%)
BTB 82..177 CDD:197585 13/52 (25%)
COG5048 425..>488 CDD:227381 27/63 (43%)
C2H2 Zn finger 427..447 CDD:275368 7/20 (35%)
zf-H2C2_2 442..464 CDD:290200 10/22 (45%)
C2H2 Zn finger 455..475 CDD:275368 7/20 (35%)
zf-H2C2_2 468..492 CDD:290200 13/24 (54%)
C2H2 Zn finger 483..503 CDD:275368 9/21 (43%)
zf-H2C2_2 495..520 CDD:290200 10/27 (37%)
C2H2 Zn finger 511..529 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.