DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb17

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_003201251.1 Gene:zbtb17 ZFINID:ZDB-GENE-090313-240 Length:856 Species:Danio rerio

Alignment Length:648 Identity:154/649 (24%)
Similarity:244/649 (38%) Gaps:191/649 (29%)


  Fly   109 EDELEF-------------EDSIA---FIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRLE 157
            |..|||             ||.:|   |:::|:.|...      ..|:....:...|.:|...||
Zfish    71 EQVLEFMYTAKLTLNAQNIEDVLAVATFLQMQEIVNAC------SAFQSLTVSSAPKPVVTEPLE 129

  Fly   158 LRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQ-------LAMLLGELE 215
            .:.|...:..:..:..|..:...| .:|.:||.:.:..:|...::.::|       ::.:.|.|:
Zfish   130 EQTKSVKKPEEPDSHSVTQKAGPE-EKEAQSQSKTEETHEAVSNVAEKQSTKTLRAVSKISGPLK 193

  Fly   216 VYLTEKKAGRWESLDGSEPETK--PQVKED--------------------ASPSRSKTKALPKRR 258
               |.:|..:.||  .:|..||  ||.::|                    .|..|||:|......
Zfish   194 ---TRQKDSKSES--EAERATKELPQFQDDPNDADYTPKLSQRMVAKRSVVSTRRSKSKYATVHT 253

  Fly   259 PSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDV 323
            .:.|:...::....:...|||     |.|.....|:..|..:.:||:..|.||      |:.|: 
Zfish   254 AAEVNDGEESVSKVESMVEEE-----NEDDGGEEDLEDDQTDGEEEMETEDGE------MMDSE- 306

  Fly   324 VHTDNGEIYIINSASSEDQNQDSTPEFDQDNG---ITSYNIKEDGEIQFSGEKPEEIEDVVVFNL 385
                 ...:.|.:..:|.::..|.....:|.|   ..:.|.|....|. :||||....|.     
Zfish   307 -----DRKFAIGAERTESRSYGSITHKCEDCGKKFTHTGNFKRHMRIH-TGEKPFTCRDC----- 360

  Fly   386 GEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLK--------------------RKRSSELVFKQ 430
             .:...:......||..            .:|:|                    |||.::   :.
Zfish   361 -NKAFSDPAACKAHEKT------------HSPVKPYCCSTCGKSYRQISLLNLHRKRHTD---EA 409

  Fly   431 ESSCPQPKTGRITDT-------------VKSFQCHLCPVAF--PTQKLLTRHHNTH--------- 471
            ..||..  .|::..|             .|.:||..|..||  ||.|:  ||..||         
Zfish   410 RYSCED--CGKLFTTSGNLKRHQLVHSGEKPYQCDHCDRAFSDPTAKM--RHLETHDTDKGHKCQ 470

  Fly   472 --------IKGLKSG-----KGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQR 523
                    :..||:.     ..|.|||..|..|.:.:.:||||:.:|:|.|||.|..|:.:|:..
Zfish   471 HCDKKFNQVGNLKAHLKIHIADGPLKCKECGKQFTTSGNLKRHLRVHSGEKPFICMHCQRAFADP 535

  Fly   524 EVLKRHMDTHTG----------------------VKRHQ------CPQCSSCFAQKSNLQQHIGR 560
            ..|:||:..|||                      |::|.      |.:|...|.|.|.|..||. 
Zfish   536 GALQRHVRIHTGEKPCLCLICGKGFTQASSLIAHVRQHTGEKPYVCDRCGKRFVQSSQLANHIR- 599

  Fly   561 VHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVK 622
             |..|.|.|||..|:::|.:|..||:|::.|.|.. |.|.:|||.||....::.||.|:|:.|
Zfish   600 -HHDNIRPHKCQTCNKAFVNVGDLSKHIIIHTGEKPFLCDKCGRGFNRVDNLRSHVKTVHQGK 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 35/180 (19%)
RRF <161..222 CDD:294170 11/68 (16%)
zf-C2H2_8 454..530 CDD:292531 33/100 (33%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 11/52 (21%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 8/19 (42%)
zbtb17XP_003201251.1 BTB 14..111 CDD:279045 10/46 (22%)
BTB 25..111 CDD:197585 10/46 (22%)
YtxH <141..222 CDD:295162 19/87 (22%)
COG5048 326..654 CDD:227381 92/356 (26%)
zf-C2H2 327..349 CDD:278523 5/22 (23%)
C2H2 Zn finger 329..349 CDD:275368 5/20 (25%)
zf-H2C2_2 341..365 CDD:290200 8/31 (26%)
C2H2 Zn finger 357..377 CDD:275368 3/38 (8%)
C2H2 Zn finger 385..405 CDD:275368 3/20 (15%)
zf-C2H2 411..433 CDD:278523 4/24 (17%)
C2H2 Zn finger 413..433 CDD:275368 3/22 (14%)
zf-H2C2_2 425..449 CDD:290200 6/24 (25%)
C2H2 Zn finger 441..461 CDD:275368 10/22 (45%)
zf-C2H2 467..489 CDD:278523 2/22 (9%)
C2H2 Zn finger 469..489 CDD:275368 2/20 (10%)
zf-H2C2_2 481..506 CDD:290200 8/25 (32%)
zf-C2H2 496..517 CDD:278523 8/21 (38%)
C2H2 Zn finger 497..517 CDD:275368 7/20 (35%)
zf-H2C2_2 509..533 CDD:290200 12/24 (50%)
C2H2 Zn finger 525..545 CDD:275368 6/20 (30%)
zf-H2C2_2 537..562 CDD:290200 6/25 (24%)
C2H2 Zn finger 553..573 CDD:275368 1/20 (5%)
zf-H2C2_2 565..590 CDD:290200 5/25 (20%)
C2H2 Zn finger 581..601 CDD:275368 9/22 (41%)
C2H2 Zn finger 609..629 CDD:275368 7/20 (35%)
zf-H2C2_2 621..646 CDD:290200 12/25 (48%)
C2H2 Zn finger 637..656 CDD:275370 8/19 (42%)
C2H2 Zn finger 761..781 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.