DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and MYNN

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001172047.1 Gene:MYNN HGNCID:14955 Length:610 Species:Homo sapiens

Alignment Length:641 Identity:148/642 (23%)
Similarity:227/642 (35%) Gaps:185/642 (29%)


  Fly    63 CRYQLEKSFLFRQR-----CQW----AEKKLRKHIRLLG-----LGKRSRVFSKDPDDYDEDELE 113
            |.:.||:  |.:||     |..    .|.:.:.|..:|.     .|...|..|::....|:.:::
Human     7 CEHLLER--LNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENNVFLDQSQVK 69

  Fly   114 ---FEDSIAFIEVQDKVRKLEDEKWREDFKE-EQAAEMHKRLVKSRLELRAKLTTELRKELAEEV 174
               |:..:.||    ....|..:.|  :.|| .|||:.   |....:..:.|:..|....:|...
Human    70 ADGFQKLLEFI----YTGTLNLDSW--NVKEIHQAADY---LKVEEVVTKCKIKMEDFAFIANPS 125

  Fly   175 RSEVRK-----ELAEEVRSQVRDDLRN----EVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLD 230
            .:|:..     ||.::.......|..|    |||.|:.:              ...|.|   :|.
Human   126 STEISSITGNIELNQQTCLLTLRDYNNREKSEVSTDLIQ--------------ANPKQG---ALA 173

  Fly   231 GSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPA------ 289
            ....:||.:.|...||...:.|.:......|.:|::            |..|..|..|.      
Human   174 KKSSQTKKKKKAFNSPKTGQNKTVQYPSDILENASV------------ELFLDANKLPTPVVEQV 226

  Fly   290 ----NNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEF 350
                :||::.:..: ::...||:             |:|||     ..:.....:.|...:..|.
Human   227 AQINDNSELELTSV-VENTFPAQ-------------DIVHT-----VTVKRKRGKSQPNCALKEH 272

  Fly   351 DQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQ-----------QVFSFHENVII 404
            ...| |.|.            :.|.|.|     |.|||:.|..           :|||       
Human   273 SMSN-IASV------------KSPYEAE-----NSGEELDQRYSKAKPMCNTCGKVFS------- 312

  Fly   405 VEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHN 469
                     |.:.|:|..                  ||...||.:.||||..||.....|..|..
Human   313 ---------EASSLRRHM------------------RIHKGVKPYVCHLCGKAFTQCNQLKTHVR 350

  Fly   470 THI-----------KG------------LKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPF 511
            ||.           ||            :..|:....||..|.||.:.:|:||.|...|:|.||:
Human   351 THTGEKPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPY 415

  Fly   512 KCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHR 576
            .|..|...|:|...|..|:..|||.|.:.|..|...||..|:|..| .|.|.| .:.:.|.:|.:
Human   416 VCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITH-SRKHTG-EKPYICGICGK 478

  Fly   577 SFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYISE 631
            ||.....|::|..:|.|.. |.|:.||..:.|...:::|.|.:|...:|..|..:|
Human   479 SFISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAE 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 8/32 (25%)
vATP-synt_E 109..>244 CDD:304907 29/148 (20%)
RRF <161..222 CDD:294170 12/70 (17%)
zf-C2H2_8 454..530 CDD:292531 29/99 (29%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
MYNNNP_001172047.1 BTB 14..115 CDD:306997 23/110 (21%)
Nuclear localization signal. {ECO:0000255} 174..190 5/16 (31%)
Nuclear localization signal. {ECO:0000255} 257..262 0/5 (0%)
C2H2 Zn finger 304..324 CDD:275368 8/54 (15%)
zf-C2H2 304..324 CDD:306579 8/54 (15%)
zf-H2C2_2 316..341 CDD:316026 12/43 (28%)
C2H2 Zn finger 332..352 CDD:275368 9/20 (45%)
zf-H2C2_2 345..369 CDD:316026 6/24 (25%)
SFP1 <354..438 CDD:227516 23/84 (27%)
C2H2 Zn finger 360..380 CDD:275368 2/20 (10%)
C2H2 Zn finger 389..409 CDD:275368 8/20 (40%)
C2H2 Zn finger 417..437 CDD:275368 6/20 (30%)
zf-H2C2_2 430..453 CDD:316026 9/23 (39%)
SFP1 <439..522 CDD:227516 27/85 (32%)
C2H2 Zn finger 445..465 CDD:275368 8/21 (38%)
C2H2 Zn finger 473..493 CDD:275368 6/20 (30%)
C2H2 Zn finger 501..522 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.