DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ZKSCAN7

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001275519.1 Gene:ZKSCAN7 HGNCID:12955 Length:754 Species:Homo sapiens

Alignment Length:492 Identity:126/493 (26%)
Similarity:197/493 (40%) Gaps:129/493 (26%)


  Fly   213 ELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDAN-LKATEARKDAK 276
            :|.|..|:||   |:||..|:    ..::.:..|....:.|      ||...| :|.:|.   ..
Human   235 DLSVDYTQKK---WKSLTLSQ----RALQWNMMPENHHSMA------SLAGENMMKGSEL---TP 283

  Fly   277 EEEFILGCNTDPANNSDVNIDGLELDEEVP--AESG---ED-FREINMVGSDV----VHTDNGEI 331
            ::||..|  ::.:|.:...:.|:     ||  ||:|   || |:|:....||.    :..|..||
Human   284 KQEFFKG--SESSNRTSGGLFGV-----VPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEI 341

  Fly   332 YIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQ--------------------------FS 370
            ...:...|.....|...|..:...::|..::.:|.::                          .:
Human   342 TDEDKKKSTKDRYDKYKEVGEHPPLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHT 406

  Fly   371 GEKPEEIED----------VVVF---NLGE---EISQEQQVFSFHENVIIVEKEQNDRDEQTPLK 419
            ||||.|..:          ::|.   :.||   |.|:..:.:....::|   :.|...:.:.|.|
Human   407 GEKPYECNECGKTFRQTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLI---QHQRLHNGEKPYK 468

  Fly   420 RKRSSELVFKQESSCPQPKTGRITD------TVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSG 478
            ....:: .|.|.|        |:||      ..|.::|:.|..||...|.|.||...|     :|
Human   469 CNECAK-AFTQSS--------RLTDHQRTHTGEKPYECNECGEAFIRSKSLARHQVLH-----TG 519

  Fly   479 KGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQ 543
            | ...||..|........:|..|..||||.||::||||..:||:.:.|.||...|||.|.::|.:
Human   520 K-KPYKCNECGRAFCSNRNLIDHQRIHTGEKPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSE 583

  Fly   544 CSSCFAQKSNLQQHIGRVHMG---------------------NSRTH------KCHLCHRSFNHV 581
            |...|.|.|.|.:| .|:|.|                     :.|.|      ||:.|.:|||..
Human   584 CGKAFNQNSQLIEH-ERIHTGEKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQN 647

  Fly   582 SGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTT 617
            |.|..|...|.|.. :.|.:||:.|:..|::..|..|
Human   648 SHLIIHQRIHTGEKPYECNECGKVFSYSSSLMVHQRT 684

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 9/31 (29%)
RRF <161..222 CDD:294170 4/9 (44%)
zf-C2H2_8 454..530 CDD:292531 30/76 (39%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 14/25 (56%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
ZKSCAN7NP_001275519.1 SCAN 51..161 CDD:128708
SCAN 51..138 CDD:280241
KRAB_A-box 231..270 CDD:143639 12/48 (25%)
COG5048 380..738 CDD:227381 86/325 (26%)
zf-C2H2 383..405 CDD:278523 0/22 (0%)
C2H2 Zn finger 385..405 CDD:275368 0/20 (0%)
zf-H2C2_2 401..422 CDD:290200 5/21 (24%)
C2H2 Zn finger 413..433 CDD:275368 1/20 (5%)
zf-H2C2_2 426..450 CDD:290200 5/24 (21%)
C2H2 Zn finger 441..461 CDD:275368 3/23 (13%)
zf-H2C2_2 453..478 CDD:290200 5/29 (17%)
C2H2 Zn finger 469..489 CDD:275368 6/29 (21%)
zf-H2C2_2 482..506 CDD:290200 7/24 (29%)
C2H2 Zn finger 497..517 CDD:275368 8/20 (40%)
zf-H2C2_2 509..532 CDD:290200 9/29 (31%)
C2H2 Zn finger 525..545 CDD:275368 5/20 (25%)
zf-H2C2_2 537..562 CDD:290200 14/25 (56%)
C2H2 Zn finger 553..573 CDD:275368 9/20 (45%)
zf-H2C2_2 566..590 CDD:290200 10/24 (42%)
C2H2 Zn finger 581..601 CDD:275368 8/21 (38%)
zf-H2C2_2 594..616 CDD:290200 5/23 (22%)
C2H2 Zn finger 609..629 CDD:275368 1/20 (5%)
zf-H2C2_2 622..646 CDD:290200 8/24 (33%)
C2H2 Zn finger 637..657 CDD:275368 8/20 (40%)
zf-H2C2_2 649..674 CDD:290200 8/25 (32%)
C2H2 Zn finger 665..685 CDD:275368 7/21 (33%)
zf-H2C2_2 677..701 CDD:290200 2/9 (22%)
C2H2 Zn finger 693..713 CDD:275368
zf-H2C2_2 706..730 CDD:290200
C2H2 Zn finger 721..741 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.