DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb24

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001018866.2 Gene:zbtb24 ZFINID:ZDB-GENE-081022-123 Length:678 Species:Danio rerio

Alignment Length:489 Identity:122/490 (25%)
Similarity:188/490 (38%) Gaps:120/490 (24%)


  Fly   187 RSQVRDDLRNEVSEDIR-KEQLAMLLGELEVY-----LTEKKAGRWESLDGSEPETKPQVKE--- 242
            ||::..|: ..:.||:. |...|:|....|.:     ..|:.:.....|||....|...|.|   
Zfish    37 RSELLCDI-TLIVEDVHFKAHKALLAASSEYFSALFTAEEQVSQSLYKLDGMTANTFSSVLEFMY 100

  Fly   243 ------DASPSRSKTKALPKRR----PSLVDA--NLKATEARKDAKEEEFILGCNTDPANNSDVN 295
                  |.|   |..:.:...|    |.|:.|  :|:|.:.....|.:      ...|..|.|::
Zfish   101 SAVVLVDES---SSEQLMEMARFLVIPDLIKAHEDLQAVDEHMQVKRK------RGRPKKNQDLS 156

  Fly   296 IDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYN 360
             .....:.|:.|:|..:.:|:|                         .:.::|..|..:|  .:|
Zfish   157 -QKENPESELQAQSSSEIQEVN-------------------------EEPASPATDGSDG--EFN 193

  Fly   361 IKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKE--QNDRDEQTPLKRKRS 423
            .:|  |.:..|::              :|.|..::..|..:.::..||  :..|..:.|....|.
Zfish   194 PRE--ERRREGKR--------------KIKQPIRLKGFRMDDLMEGKEPGKRGRRRKYPDTEARC 242

  Fly   424 SEL--VFKQESSCPQPKTGRITDT-VKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKC 485
            .|.  |||.....   |..:.|.| .|.|:|.:|...|..:..|..|...|     :|:...: |
Zfish   243 EECGKVFKSHLFL---KIHQRTHTGEKPFRCSVCGKEFTQKHTLLVHQRMH-----TGEKPYI-C 298

  Fly   486 PSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQRE-------------------------- 524
            ..|:..||...||..||.:||..|.|.|.||..||||:.                          
Zfish   299 TVCSKALSTKHSLLEHMNLHTENKLFTCEECGKSFSQQRQLKSHNRVHTGKGLPECAECHHKFMD 363

  Fly   525 --VLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRH 587
              .||:|:.||||.|...|..|..||..||.||.|| |:|.| .:.:.|.:|.::|:..|...||
Zfish   364 AAQLKKHLRTHTGEKPFTCEICGKCFTAKSTLQTHI-RIHRG-EKPYVCKVCDKTFSDPSARRRH 426

  Fly   588 LVTHAG-VMFSCKQCGRQFNDRSAVQRHVTTMHK 620
            .|:|.| ..|||..|...|..:..::.|:.|.:|
Zfish   427 EVSHTGKKTFSCSICKVSFARKDNLKAHIKTHNK 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 17/72 (24%)
RRF <161..222 CDD:294170 10/41 (24%)
zf-C2H2_8 454..530 CDD:292531 28/104 (27%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 14/25 (56%)
C2H2 Zn finger 513..533 CDD:275368 11/48 (23%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 11/21 (52%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 4/19 (21%)
zbtb24NP_001018866.2 BTB 32..129 CDD:279045 22/96 (23%)
BTB 43..129 CDD:197585 20/90 (22%)
C2H2 Zn finger 242..262 CDD:275368 6/23 (26%)
zf-H2C2_2 255..279 CDD:290200 8/27 (30%)
COG5048 <266..456 CDD:227381 64/198 (32%)
C2H2 Zn finger 270..290 CDD:275368 5/20 (25%)
zf-H2C2_2 283..307 CDD:290200 8/30 (27%)
C2H2 Zn finger 298..318 CDD:275368 8/20 (40%)
zf-H2C2_2 310..335 CDD:290200 14/25 (56%)
zf-C2H2 324..346 CDD:278523 8/22 (36%)
C2H2 Zn finger 326..346 CDD:275368 7/20 (35%)
C2H2 Zn finger 354..374 CDD:275368 4/20 (20%)
zf-H2C2_2 367..390 CDD:290200 12/23 (52%)
C2H2 Zn finger 382..402 CDD:275368 11/21 (52%)
zf-H2C2_2 395..418 CDD:290200 10/25 (40%)
C2H2 Zn finger 410..430 CDD:275368 7/20 (35%)
zf-C2H2 436..458 CDD:278523 7/22 (32%)
C2H2 Zn finger 438..458 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.