DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb26

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001016018.1 Gene:zbtb26 XenbaseID:XB-GENE-5891654 Length:415 Species:Xenopus tropicalis

Alignment Length:364 Identity:90/365 (25%)
Similarity:135/365 (37%) Gaps:111/365 (30%)


  Fly   294 VNIDGLELDEEVPAESGEDFREINMVGSDVVH-----TDNGEIYIINSASSEDQNQ--------- 344
            |:||    |.|||..     |.:...||..:.     :|:||::|....:|:...|         
 Frog    37 VHID----DTEVPGH-----RVVFAAGSPYLRDQFLLSDSGEVHISILQNSQAGKQLLLSCYTGV 92

  Fly   345 DSTPEFDQDNGIT------------------------SYNIKEDGE--------IQFSGEKPEEI 377
            ...||.:..|.:|                        |...|:||:        |:...|:.|||
 Frog    93 LEFPEMELVNYLTAASFLQMSHVVERCTEALWKFIKPSQERKDDGQETSVDKHVIEQEEEEEEEI 157

  Fly   378 ED-----------------------VVVFNLGE------EISQEQQVFS----FH-----ENVII 404
            ||                       |.:.::||      ::.|.|.:.|    .|     .::|.
 Frog   158 EDTLQPESPVATHSEDSLDNDDIQIVKIESIGEVTSDKTKVCQSQYISSEQTALHSLEPQHSLIN 222

  Fly   405 VEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKT-----GRITDTVKSF--QCHLCPVAFPTQK 462
            ...|....|...||.....|:  ...::..|..|.     .||.|....:  ||..|...|    
 Frog   223 STVENRTGDADNPLHNYTMSD--NSSDNMGPPAKELFGPGNRIVDKTLQWHHQCPKCTRVF---- 281

  Fly   463 LLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLK 527
               ||...:...||..|  ...|..|....:...:|.|||.:|.|:|||:|..|..:|||:..|:
 Frog   282 ---RHLENYANHLKMHK--LFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQ 341

  Fly   528 RHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNS 566
            .|::.|:|.|.|:|..|...||.|..|::|:.::|..||
 Frog   342 DHLNLHSGDKPHKCNYCDMVFAHKPVLRKHLKQLHGKNS 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/76 (33%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
zbtb26NP_001016018.1 BTB 23..123 CDD:279045 20/95 (21%)
BTB 34..127 CDD:197585 20/99 (20%)
C2H2 Zn finger 274..294 CDD:275368 7/27 (26%)
zf-C2H2 297..319 CDD:278523 6/22 (27%)
C2H2 Zn finger 299..319 CDD:275368 6/20 (30%)
zf-H2C2_2 314..336 CDD:290200 12/22 (55%)
C2H2 Zn finger 327..347 CDD:275368 7/20 (35%)
zf-H2C2_2 339..364 CDD:290200 10/25 (40%)
C2H2 Zn finger 355..373 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.