DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb40

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_002937082.2 Gene:zbtb40 XenbaseID:XB-GENE-967576 Length:1351 Species:Xenopus tropicalis

Alignment Length:813 Identity:159/814 (20%)
Similarity:271/814 (33%) Gaps:277/814 (34%)


  Fly     2 DAQPSYPD-LATLCRLCLKEH-------------------QDAYAIFDEDD-------------- 32
            |.|....| :..|.:||...|                   ::|..:|.|:.              
 Frog   403 DGQSIVVDTVLALLKLCRHTHPSVNKALLEKEPTEQESSVEEAAPVFTEEKGKSLFELLLEHKED 467

  Fly    33 -----TQLSIPVRLMACV-ALDAKATDTLPKRICQEC------RYQLEKSFLFRQRCQWAEKKLR 85
                 |:|| |:  :.|| ..:.....||.|::..:|      |..:|:  |.|:..:.......
 Frog   468 LIQCITELS-PI--IECVDTAEEGFLSTLEKQVIVDCCEGGSHREAMER--LVRKASETRTLSPN 527

  Fly    86 KHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIE----------VQDKVRKLED-----EKW 135
            ..|:||...:.:                |.|..|.:|          ::||:...:.     .::
 Frog   528 SLIKLLQAVREA----------------FPDLHALLEMLEPQSSNPCLKDKMTTTDYGAELLRQY 576

  Fly   136 REDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVR------------------------- 175
            :|:|.|   ......|:.|.:.....|||..|:.:.:.|:                         
 Frog   577 QENFSE---VVTDSELMLSAITTTVNLTTHEREVMEQVVKKNTTSKIFSTLVSMVLDEQTLAVTA 638

  Fly   176 -------------------SEVRKELAEEVRSQVRDDLRNEVSEDI--RKEQLAMLLGELEV--Y 217
                               .|:|||...||..|...:..||.:|.:  ..|.:|...|:.::  |
 Frog   639 LWLLLLAMQESNPSLKSLMEEIRKEPGAEVFFQSVINRGNEAAEVLVRHNELIAQAFGQCDILSY 703

  Fly   218 LTEKKAGRWESLDGSEPETKPQVKEDAS-PSRS-KTKALPKRRPSLVDANLKATEARKDAKEEEF 280
            :..|:....:.:  .|....||..||:. ||:. .:.||....|::...:|..|........:..
 Frog   704 VPSKETALTDLV--KELLKVPQQNEDSELPSKMLLSAALQHTVPAMSFCSLLFTVQGSSPHLQPV 766

  Fly   281 ILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYII---NSASSEDQ 342
            |          .::...|:.::.|   ||.:.....|:         |.|..::   :||...|:
 Frog   767 I----------KELKQIGILMEGE---ESFQGVSRWNV---------NSECQLVVAEDSAEGNDE 809

  Fly   343 NQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQ--------QVFSFH 399
            .:.           |.|:..|||:  .|.|..:.::        |:.|.::        ::|.|.
 Frog   810 EEQ-----------TKYDENEDGD--SSKESKDSVQ--------EKGSSKKNFICKSCDKIFLFR 853

  Fly   400 ENVIIVEKEQNDRDEQTPLKRKRSSELVFKQE--------------SSCPQPKTGRITDTVKSFQ 450
            .. :.|..::....::.||:.|..:|:...::              ||.......|:..|     
 Frog   854 CR-LEVHMKRCRMAKRNPLQCKDCNEIQSSRKELDQHREAVHGYLVSSRTNKGRRRLLVT----- 912

  Fly   451 CHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSE 515
            |.:|...|.....|..|..|.....|     ...|..|..:.:..|:||.|..:|||.:||.|..
 Frog   913 CDICGKEFAHPSGLQYHKRTEHFDEK-----PFSCDECGAKFAANSTLKNHQRLHTGERPFVCKH 972

  Fly   516 CELSFSQREVLK-----------------------------RHMDTHTGVKRHQCPQCSSCFAQK 551
            |.::|:|...|.                             ||:.||||.|.:.|.:|...|:|.
 Frog   973 CHMTFTQAAALSYHTKKKHSEGKMYACQYCDAVFAQSIELTRHVRTHTGDKPYVCRECGKGFSQA 1037

  Fly   552 SNL-----------------------------QQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRH 587
            :.|                             :|||..||  :...|.|..|.:.|:..|.|.||
 Frog  1038 NGLSIHLRTFHNIEDPYDCQKCRMSFPTLEENRQHIQVVH--SKEYHPCPTCDKIFSAPSLLERH 1100

  Fly   588 LVTH-AGVMFSCKQCGRQFNDRSAVQRHVTTMH 619
            :||| .|..::|:.|.:.:...|.:..|..|.|
 Frog  1101 VVTHVGGKPYNCEICDKAYQQLSGLWYHNRTHH 1133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 21/118 (18%)
vATP-synt_E 109..>244 CDD:304907 36/198 (18%)
RRF <161..222 CDD:294170 20/109 (18%)
zf-C2H2_8 454..530 CDD:292531 24/105 (23%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 8/49 (16%)
zf-H2C2_2 526..550 CDD:290200 11/53 (21%)
C2H2 Zn finger 541..562 CDD:275368 9/50 (18%)
C2H2 Zn finger 571..591 CDD:275368 9/20 (45%)
C2H2 Zn finger 598..617 CDD:275368 4/19 (21%)
zbtb40XP_002937082.2 BTB 19..113 CDD:279045
BTB 25..113 CDD:197585
C2H2 Zn finger 873..903 CDD:275368 4/30 (13%)
COG5048 <912..1074 CDD:227381 39/172 (23%)
C2H2 Zn finger 913..934 CDD:275368 6/21 (29%)
C2H2 Zn finger 942..962 CDD:275368 6/20 (30%)
zf-H2C2_2 955..979 CDD:290200 11/24 (46%)
C2H2 Zn finger 970..1019 CDD:275368 8/49 (16%)
zf-H2C2_2 1011..1036 CDD:290200 10/25 (40%)
C2H2 Zn finger 1027..1046 CDD:275368 5/19 (26%)
C2H2 Zn finger 1056..1077 CDD:275370 4/21 (19%)
C2H2 Zn finger 1084..1103 CDD:275368 8/19 (42%)
C2H2 Zn finger 1112..1132 CDD:275368 5/20 (25%)
zf-C2H2_8 1151..1232 CDD:292531
C2H2 Zn finger 1151..1169 CDD:275368
C2H2 Zn finger 1180..1201 CDD:275368
C2H2 Zn finger 1209..1228 CDD:275368
C2H2 Zn finger 1240..1256 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.