DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zscan4d

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001093656.1 Gene:Zscan4d MGIID:3645954 Length:506 Species:Mus musculus

Alignment Length:554 Identity:125/555 (23%)
Similarity:185/555 (33%) Gaps:157/555 (28%)


  Fly   106 DYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRLELRAKLTTELRKEL 170
            |...:.|||..|.:           ...:|.||.....:|:::    .|........|.|| :.|
Mouse    10 DLQTNNLEFTPSHS-----------SGVQWVEDISNSPSAQLN----FSPSNNGCWATQEL-QSL 58

  Fly   171 AEEVRS--EVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGEL--EVYLTEKKAGRWE---- 227
            .:...|  :..|:..|::.||:       |.|..      :|:|..  :..||||    |:    
Mouse    59 WKMFNSWLQPEKQTKEQMISQL-------VLEQF------LLIGHCKDKYALTEK----WKASGS 106

  Fly   228 ----------------------SLDGSE---PETKP--QVKEDASPSRSKTKALPKRRPSLVDA- 264
                                  |:.|.|   .|..|  :|.:.....:|.|:..|......||. 
Mouse   107 DMRRFMESLTDECLKPPVMVHVSMQGQEALFSENMPLKEVIKLLKQQQSATRPTPDNEQMPVDTT 171

  Fly   265 --NLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDE--EVPAESGEDFREINMVGS---D 322
              .|.||  .::..|.|....||...||..: :..|.|:|.  .:..|...:..|.|:|..   |
Mouse   172 QDRLLAT--GQENSENECNNSCNATEANVGE-SCSGNEMDSLLIIQKEQYPEHEEGNVVFQFPLD 233

  Fly   323 VVHTDNGEIYIINSASSEDQNQDSTPE----FDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVF 383
            ......|     ||:...|.....||.    .:|...::..||.||....::..:          
Mouse   234 ARRASQG-----NSSHHVDFRSAPTPADVPMEEQPKDLSRENISEDKNNCYNTSR---------- 283

  Fly   384 NLGEEISQEQQV-------FSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGR 441
            |...::.:...:       .|.::.:...|.|:.|.....|....|:|:    ..|:|.|...|.
Mouse   284 NAATQVYRSDNIPRKKTDSLSINKRIYHSEPEEGDIPYGVPQDSTRASQ----GTSTCLQESLGE 344

  Fly   442 --------------------ITDTV-----------------------KSFQCHLCPVAFPTQKL 463
                                |:|.|                       |.|:|..|...|...:.
Mouse   345 CFSEKDPRELPGLESRQEEPISDPVFLGKDHEANLPCESHQKRFRRDAKLFKCEECSRMFKHARS 409

  Fly   464 LTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKR 528
            |:.|..||:     .|...|.|.:|.......|..:.|.|||...||||||.||.|||.:..||.
Mouse   410 LSSHQRTHL-----NKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKS 469

  Fly   529 HMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVH 562
            |...|||...:.|..||..|.|.|...:|:...|
Mouse   470 HEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYH 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 33/170 (19%)
RRF <161..222 CDD:294170 17/65 (26%)
zf-C2H2_8 454..530 CDD:292531 29/76 (38%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 15/25 (60%)
C2H2 Zn finger 513..533 CDD:275368 10/20 (50%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Zscan4dNP_001093656.1 SCAN <51..117 CDD:295388 18/84 (21%)
zf-C2H2 395..417 CDD:278523 7/22 (32%)
C2H2 Zn finger 397..417 CDD:275368 6/20 (30%)
C2H2 Zn finger 426..446 CDD:275368 6/20 (30%)
zf-H2C2_2 438..463 CDD:290200 15/25 (60%)
C2H2 Zn finger 454..474 CDD:275368 10/20 (50%)
zf-H2C2_2 466..491 CDD:290200 10/25 (40%)
C2H2 Zn finger 482..500 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.