DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp286a

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001178850.1 Gene:Zfp286a RGDID:1561950 Length:520 Species:Rattus norvegicus

Alignment Length:566 Identity:144/567 (25%)
Similarity:214/567 (38%) Gaps:148/567 (26%)


  Fly   141 EEQAAEM-HKRLVKSRLELRAKLTTELRKELAEE-----VRSEVRKELAEEVRSQVRDDLRNE-- 197
            |...||: .||.:.|:..|       |.:|.:.|     :|...|.:.|...:....|....|  
  Rat     8 ETDLAEVPQKRALSSQDSL-------LSQEKSAEGDVAALRLTARPQEAVTFKDVAMDFTPEEWG 65

  Fly   198 ----VSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDG---------------SEPETKPQVKED 243
                |..|:..|....|   :.::|...|...::|.||               |:.||:|:.||.
  Rat    66 KLDPVHRDVMLENYRNL---VSLWLPISKPDDYDSEDGKELLKLERKSPKCSDSDVETRPESKES 127

  Fly   244 AS----PSRSKTKALPKRRPSLVDANLK-ATEAR-----KDAKEEEFILGCNTDPANNSDVNIDG 298
            .|    |.....|...|   :..|.::: |.|..     :....|:.....:|.|  ||      
  Rat   128 TSVLDFPKEESDKRTQK---TAFDPHVETALECEHWLEPQQGNREKHPRQVSTHP--NS------ 181

  Fly   299 LELDEEVPAESGEDFREI-----------NMVGSDVVHT-------------------------- 326
              |.||..:|....:|..           ::.||...||                          
  Rat   182 --LPEEGDSECDVYWRNFSQKPCLMTDDRDLEGSCDFHTLEERLKQKSKFMKKQRPYKDKKPHKC 244

  Fly   327 -DNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGE----KPEEIEDVVVFNLG 386
             |.||::..:|.....|...:        |...|:..|.|: .||..    |.:.....|:|..|
  Rat   245 DDCGELFTYHSVLIRHQRVHT--------GEKPYSCSECGK-SFSHRANLTKHQRTHTRVLFECG 300

  Fly   387 E--EISQEQQVFSFHENVIIVEKEQNDRDEQTPLK-------RKRSSELVFKQESSCPQPKTGRI 442
            |  :...|....:.|:.:.|.|:         |.:       ..||:.|...|          .|
  Rat   301 ECKKTFIESSALAVHQRIHIGER---------PYECGECGKGFNRSTHLAQHQ----------LI 346

  Fly   443 TDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTG 507
            ...||.::|:.|..||.....|.:|..|| .|.|     ..||..|....|..|||.:|..:|||
  Rat   347 HTGVKPYECNECDKAFIHSSALIKHQRTH-TGEK-----PYKCQECGKAFSHCSSLTKHQRVHTG 405

  Fly   508 LKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCH 572
            .||::||||..:|||...|.:|...|||.|.::|.:|...|::.||..:| .|:|:| .:.:||.
  Rat   406 EKPYECSECGKTFSQSTHLVQHQRIHTGEKPYECHECGKTFSRSSNFAKH-QRIHVG-KKPYKCG 468

  Fly   573 LCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTT 617
            .|.::|.|.|.|.:|..||.|.. |.|.:||:.|...|::.||..|
  Rat   469 ECGKAFIHSSALIQHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRT 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 30/130 (23%)
RRF <161..222 CDD:294170 13/72 (18%)
zf-C2H2_8 454..530 CDD:292531 31/76 (41%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 14/25 (56%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 7/19 (37%)
Zfp286aNP_001178850.1 KRAB 50..>94 CDD:214630 8/47 (17%)
KRAB 50..85 CDD:279668 6/38 (16%)
COG5048 <240..422 CDD:227381 58/216 (27%)
C2H2 Zn finger 244..264 CDD:275368 5/20 (25%)
zf-H2C2_2 257..281 CDD:290200 7/33 (21%)
C2H2 Zn finger 272..292 CDD:275368 5/21 (24%)
C2H2 Zn finger 299..319 CDD:275368 4/20 (20%)
zf-H2C2_2 311..336 CDD:290200 4/34 (12%)
C2H2 Zn finger 327..347 CDD:275368 5/30 (17%)
zf-H2C2_2 339..362 CDD:290200 8/33 (24%)
COG5048 <351..506 CDD:227381 62/163 (38%)
zf-C2H2 353..375 CDD:278523 7/22 (32%)
C2H2 Zn finger 355..375 CDD:275368 7/20 (35%)
zf-H2C2_2 367..392 CDD:290200 10/31 (32%)
C2H2 Zn finger 383..403 CDD:275368 7/20 (35%)
zf-H2C2_2 395..420 CDD:290200 14/25 (56%)
C2H2 Zn finger 411..431 CDD:275368 9/20 (45%)
zf-H2C2_2 423..448 CDD:290200 9/25 (36%)
C2H2 Zn finger 439..459 CDD:275368 7/21 (33%)
zf-H2C2_2 451..474 CDD:290200 8/25 (32%)
zf-C2H2 465..487 CDD:278523 9/22 (41%)
C2H2 Zn finger 467..487 CDD:275368 8/20 (40%)
zf-H2C2_2 479..504 CDD:290200 10/25 (40%)
C2H2 Zn finger 495..515 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.