DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG1792

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster

Alignment Length:302 Identity:77/303 (25%)
Similarity:125/303 (41%) Gaps:52/303 (17%)


  Fly   347 TPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQND 411
            :|.......|.|:.:..:.|||::    ||:.::.|.:|   :.:|..:....|...|.  |||:
  Fly    81 SPNLGNAELIESFAVGVEKEIQYA----EEVTEIEVIDL---LPEEHLLEETEEPYEIC--EQNE 136

  Fly   412 RDE-QTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGL 475
            :.: :.|.:.|:..             ::.:.|.||      ...|.|......||   |....|
  Fly   137 QPQVKVPAQEKKLR-------------RSTKTTPTV------FTSVKFADNSQATR---TQWSRL 179

  Fly   476 KSGKGGTLK---------CPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMD 531
            ...:...||         |..|....:|.|:.|.|::.|||:|.|.|.:|...|....:|:||.:
  Fly   180 TEDEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQE 244

  Fly   532 THTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGV-M 595
            .|.|....||..|.:.::..|...|| .|:...|.:...|..|::||.....|..|:::|.|| .
  Fly   245 LHAGNALFQCRYCEATYSNASGRIQH-ERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRA 308

  Fly   596 FSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYISETNEFQA 637
            |.|..|...|..||    |:|:.::.|..     :.|:..||
  Fly   309 FHCDSCQVSFVRRS----HLTSHYRSKGH-----AHTSSAQA 341

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/85 (29%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 8/24 (33%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 7/19 (37%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 6/20 (30%)
C2H2 Zn finger 226..243 CDD:275368 6/17 (35%)
C2H2 Zn finger 254..275 CDD:275368 6/22 (27%)
zf-C2H2 281..303 CDD:278523 6/22 (27%)
C2H2 Zn finger 283..303 CDD:275368 6/20 (30%)
zf-H2C2_2 296..320 CDD:290200 9/24 (38%)
C2H2 Zn finger 311..329 CDD:275368 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.