DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and hic1

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001002314.1 Gene:hic1 ZFINID:ZDB-GENE-040713-2 Length:737 Species:Danio rerio

Alignment Length:394 Identity:87/395 (22%)
Similarity:141/395 (36%) Gaps:69/395 (17%)


  Fly   270 EARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAE--------------SGEDFREINMVG 320
            :.|:||  .........:|:|..|.:.|..|.|.....|              |.|:....|..|
Zfish   331 DQRRDA--SNIYRWVKNEPSNPEDEDEDDEEDDSGGMGEQDKERHHQHMNHHKSNEEKLNTNERG 393

  Fly   321 SDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVV--- 382
            .|....|:|          ||:|...:.|.....|..|..: ..|......| ||...|.:.   
Zfish   394 YDRGTCDDG----------EDENGTGSEETGSSEGRPSPPV-PGGRYHMPYE-PESFGDNLYVCI 446

  Fly   383 -----FNLGEEISQEQQVFSFHE--NVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQP-KT 439
                 |...|:::...:..:..|  |...::...|...:.|.::...|    ....|....| ..
Zfish   447 PCDKGFPSSEQLNAHVETHTEEELNNGSEMDSSNNSNSKPTTVRAPTS----LNSSSGLHSPYHD 507

  Fly   440 GRIT---------DTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCA 495
            |::.         :.::.::|..|..::.....|.:|..||      .......|..|..:.:..
Zfish   508 GKLAQNLHSIGLGEIIRPYRCSSCDKSYKDPATLRQHEKTH------WLTRPYPCSICGKKFTQR 566

  Fly   496 SSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGR 560
            .::.|||..|.|||||.|..|.:.|:::..|..||..|:|.|.::|..|...|||:.||..|: :
Zfish   567 GTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKFAQQRNLISHM-K 630

  Fly   561 VH----MGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQCGRQFNDRSAVQRHVTTMHKV 621
            :|    .|...|....|.......:..||::...|.|:    ||  .:.:|..|..:|:....|.
Zfish   631 MHSSGAAGGGLTPDGKLKIDFSEGIYPLSKYTAEHLGL----KQ--EKTSDLLAASQHLLADAKA 689

  Fly   622 KNKL 625
            ...|
Zfish   690 MESL 693

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 21/76 (28%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 3/20 (15%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
hic1NP_001002314.1 BTB 18..119 CDD:279045
BTB 29..119 CDD:197585
C2H2 Zn finger 445..465 CDD:275368 2/20 (10%)
C2H2 Zn finger 528..548 CDD:275368 5/20 (25%)
zf-H2C2_2 541..565 CDD:290200 6/30 (20%)
zf-C2H2 554..576 CDD:278523 5/22 (23%)
C2H2 Zn finger 556..576 CDD:275368 5/20 (25%)
zf-H2C2_2 569..593 CDD:290200 12/24 (50%)
C2H2 Zn finger 584..604 CDD:275368 6/20 (30%)
zf-H2C2_2 597..621 CDD:290200 10/24 (42%)
C2H2 Zn finger 612..632 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.