DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp708

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001012325.2 Gene:Zfp708 MGIID:3040674 Length:541 Species:Mus musculus

Alignment Length:333 Identity:96/334 (29%)
Similarity:138/334 (41%) Gaps:36/334 (11%)


  Fly   308 ESGEDFR-EINMVGSDVVHT--------DNGEIYIINSASSEDQNQDS--TPEFDQDNG---ITS 358
            |.|:.|. ..|::....:||        :.|:.:.|.|.....|...|  .|...:|.|   ...
Mouse   209 ECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNC 273

  Fly   359 YNIKEDGEIQFSGEKPEEIEDV-VVFNLGEEISQEQQVFSFHE--NVIIVEKEQNDRDEQTPLKR 420
            ||:.:...|. :||||...|:. ..||....:.|.:::.:..:  ...:..|..|..|.....:|
Mouse   274 YNLIQHQRIH-TGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQR 337

  Fly   421 KRSSELVFKQESSCPQP--------KTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKS 477
            ..:.|..:|.| .|.:.        |..||....|.::|..|..||.....|..|...| .|.| 
Mouse   338 IHTGEKPYKCE-VCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVH-TGEK- 399

  Fly   478 GKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCP 542
                ..||..|....|..:||.:|..|||..:|:||.||..:||......:|...||..|.::|.
Mouse   400 ----PYKCEECGKAFSVHTSLSKHQRIHTREQPYKCDECGKTFSVHSTFSKHQIMHTREKPYKCK 460

  Fly   543 QCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFN 606
            .|...|...|.|.|| .|:|.| .|.:||.:|.::|...|.|..|...|.|.. :.|:|||:.|.
Mouse   461 HCDKTFKYPSPLVQH-ERIHTG-ERPYKCEVCGKAFTSSSNLKYHWRLHTGEKPYKCEQCGKAFK 523

  Fly   607 DRSAVQRH 614
            :.|.|.||
Mouse   524 NSSNVTRH 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 26/76 (34%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 7/24 (29%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 9/18 (50%)
Zfp708NP_001012325.2 KRAB 17..77 CDD:214630
KRAB 17..56 CDD:279668
C2H2 Zn finger 95..115 CDD:275368
COG5048 119..540 CDD:227381 96/334 (29%)
C2H2 Zn finger 123..143 CDD:275368
zf-H2C2_2 136..160 CDD:290200
C2H2 Zn finger 151..171 CDD:275368
C2H2 Zn finger 179..199 CDD:275368
zf-H2C2_2 191..216 CDD:290200 3/7 (43%)
C2H2 Zn finger 207..227 CDD:275368 4/18 (22%)
zf-H2C2_2 219..243 CDD:290200 4/24 (17%)
C2H2 Zn finger 235..255 CDD:275368 4/20 (20%)
zf-H2C2_2 248..272 CDD:290200 5/24 (21%)
C2H2 Zn finger 263..283 CDD:275368 5/20 (25%)
zf-H2C2_2 275..300 CDD:290200 9/26 (35%)
C2H2 Zn finger 291..311 CDD:275368 4/20 (20%)
zf-H2C2_2 303..328 CDD:290200 3/25 (12%)
C2H2 Zn finger 319..339 CDD:275368 4/20 (20%)
zf-H2C2_2 331..355 CDD:290200 5/25 (20%)
C2H2 Zn finger 347..367 CDD:275368 5/21 (24%)
C2H2 Zn finger 375..395 CDD:275368 6/20 (30%)
zf-H2C2_2 388..411 CDD:290200 8/29 (28%)
C2H2 Zn finger 403..423 CDD:275368 7/20 (35%)
zf-H2C2_2 415..439 CDD:290200 12/24 (50%)
C2H2 Zn finger 431..451 CDD:275368 6/20 (30%)
C2H2 Zn finger 459..479 CDD:275368 8/21 (38%)
zf-H2C2_2 472..496 CDD:290200 11/26 (42%)
C2H2 Zn finger 487..507 CDD:275368 6/20 (30%)
C2H2 Zn finger 515..535 CDD:275368 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.