DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG4936

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster

Alignment Length:633 Identity:139/634 (22%)
Similarity:240/634 (38%) Gaps:171/634 (27%)


  Fly     3 AQPSYPDLAT----LCRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQEC 63
            |.|:....:|    :||:||::.::..|....||::..:...:..|..:..|..|..|.:||::|
  Fly     8 ASPAAAATSTQKWIVCRVCLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKC 72

  Fly    64 RYQLEKSFLFRQRCQWAEKKLRKHIRLLGLGKR------SRVFSKDPDDYDEDELEFEDSIAFIE 122
            ...|:.:|.||:.||.:...||:.:..:.:.:|      |...:|...|.|.||.|.|..   .:
  Fly    73 FKVLKMAFKFRETCQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPE---HD 134

  Fly   123 VQDKVRKLEDEKWRE--DFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKE--LA 183
            .:|:...|::..:.|  |..|.|....|.       |:...:..||.|:....|::|..:|  :.
  Fly   135 EEDEDVDLDESHYAEADDAAETQGGVFHD-------EIEDGILVELEKDRIVHVKNEQVEEDGII 192

  Fly   184 EEVRSQVRDDLRNEVSED--IRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASP 246
            ||| ..|.:....::..|  ...|.....|.||...:        |.||..|.:   |:.|.|..
  Fly   193 EEV-YDVYETYEGDLIPDQGYDHEMADQALSELSAEI--------EYLDQVEHD---QLTESAHE 245

  Fly   247 SRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEE--VPAES 309
            ..::           ||.|         :.||||:      |:.:...:|......:.  .|..|
  Fly   246 DDAE-----------VDLN---------STEEEFV------PSKSVRASIHARNATKRRVNPRRS 284

  Fly   310 GEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKP 374
            ......:.:..|....||.|....:...:|             |:..:..:||.:.:|       
  Fly   285 ATSTASVAVESSTSKTTDRGNPLKVRRGNS-------------DSAGSKMSIKSEKDI------- 329

  Fly   375 EEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKT 439
                     ::||.::::      |..:                |.|...:::...:        
  Fly   330 ---------SIGEVLARK------HSGI----------------KTKGGHKILLGDK-------- 355

  Fly   440 GRITDTVKSFQ--CHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHM 502
                   |.|:  |.:|...:|:|..||.    |||                             
  Fly   356 -------KEFKYICDVCGNMYPSQSRLTE----HIK----------------------------- 380

  Fly   503 IIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSR 567
             :|:|:||.:|..|...|:|.:.|.|||:||||.:.::|..|.:.||..|...:| .|:|. |.|
  Fly   381 -VHSGVKPHECEICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKH-HRIHT-NER 442

  Fly   568 THKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
            .::|.:||::|.:.:.|..|.:.|.|.. ..|..||:.|.....::.|
  Fly   443 PYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNH 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 22/73 (30%)
vATP-synt_E 109..>244 CDD:304907 33/141 (23%)
RRF <161..222 CDD:294170 15/65 (23%)
zf-C2H2_8 454..530 CDD:292531 19/76 (25%)
C2H2 Zn finger 485..505 CDD:275368 0/20 (0%)
zf-H2C2_2 497..522 CDD:290200 7/25 (28%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 5/18 (28%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 22/73 (30%)
C2H2 Zn finger 362..382 CDD:275368 9/54 (17%)
zf-H2C2_2 375..399 CDD:290200 12/58 (21%)
COG5048 386..>447 CDD:227381 25/63 (40%)
C2H2 Zn finger 390..410 CDD:275368 9/20 (45%)
zf-H2C2_2 403..426 CDD:290200 11/23 (48%)
C2H2 Zn finger 418..438 CDD:275368 7/21 (33%)
zf-H2C2_2 432..455 CDD:290200 9/25 (36%)
C2H2 Zn finger 446..466 CDD:275368 6/20 (30%)
zf-H2C2_2 459..481 CDD:290200 7/22 (32%)
C2H2 Zn finger 474..494 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.