DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and trem

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster

Alignment Length:644 Identity:129/645 (20%)
Similarity:209/645 (32%) Gaps:243/645 (38%)


  Fly    13 LCRLCLKEHQDA----YAIFDED-DTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFL 72
            :||:||....:.    :.||.|. .|:|.  ..|..|..:.....|..|.::|.:|...|...:.
  Fly    11 VCRVCLNNPSEGEELLHDIFSETASTRLD--QMLHICAGIPVSLDDNFPDKMCSKCVRCLRLCYK 73

  Fly    73 FRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWRE 137
            ||..||      |.|..::                  |.|:.|.|.|                  
  Fly    74 FRLTCQ------RSHQHIM------------------DMLDREASNA------------------ 96

  Fly   138 DFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDI 202
                 .||.....|                 .:||::..|...:..|:..||:...::.|..||.
  Fly    97 -----NAAGEGDLL-----------------SIAEDLSVESVLKSWEDYASQLDGGMKVEGEEDQ 139

  Fly   203 RKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLK 267
            :.:.:        .|:.|         ||                                    
  Fly   140 QHQVI--------TYVVE---------DG------------------------------------ 151

  Fly   268 ATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEV-PAESGEDFREINMVGSDVVHTDNGEI 331
                             :||..|..||:.....:..|: .||:..::.|..::            
  Fly   152 -----------------DTDDTNMFDVHDPTQPVPNEIEEAETYAEYEEYELL------------ 187

  Fly   332 YIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEE--IEDVVVFNLGEEISQEQQ 394
                       ..:::||..|:.|.|..::..:       |.|||  .||:        :..::.
  Fly   188 -----------TNENSPEIAQEKGSTGTDVATE-------EPPEEEIAEDI--------LDSDED 226

  Fly   395 VFSFHENVIIVEKEQNDRDEQTPLKRKRSSELV--FKQESSCPQPKTGR-ITDTVKSFQCHLCPV 456
            ....|     .:.|:.||..:.|:...::|..|  ||:       |.|| ..:.:.::.|.:|..
  Fly   227 YDPTH-----AKPEKCDRSGRKPVAYHKNSPKVETFKK-------KVGRKPRNKLSTYICDVCGN 279

  Fly   457 AFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFS 521
            .:|||..||                                  .||..|:|:||.:|..|...|.
  Fly   280 IYPTQARLT----------------------------------EHMKFHSGVKPHECEICGRGFV 310

  Fly   522 QREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSR 586
            |.:.|.|||:||||.:.::|..|.:.||.:|...:| .|:|. ..|.:.|.:|.|:|.:...|..
  Fly   311 QNQQLVRHMNTHTGNRPYKCNYCPAAFADRSTKTKH-HRIHT-KERPYVCDVCSRTFTYSDNLKF 373

  Fly   587 HLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHK---------VKNKLTDYISETNEF 635
            |.:.|.|.. ..|..||:.|.....::.|..|.::         ...|..|...||.||
  Fly   374 HKMIHTGEKPHVCDLCGKGFVKAYKLRLHRETHNRRITWRNDAEESTKAEDVKGETPEF 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 21/78 (27%)
vATP-synt_E 109..>244 CDD:304907 21/135 (16%)
RRF <161..222 CDD:294170 11/61 (18%)
zf-C2H2_8 454..530 CDD:292531 19/76 (25%)
C2H2 Zn finger 485..505 CDD:275368 2/20 (10%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 9/20 (45%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
tremNP_650861.1 zf-AD 11..87 CDD:214871 22/102 (22%)
COG5048 <264..411 CDD:227381 48/183 (26%)
C2H2 Zn finger 274..294 CDD:275368 9/54 (17%)
zf-H2C2_2 287..311 CDD:290200 11/58 (19%)
C2H2 Zn finger 302..322 CDD:275368 9/20 (45%)
zf-H2C2_2 315..338 CDD:290200 11/23 (48%)
C2H2 Zn finger 330..350 CDD:275368 7/21 (33%)
zf-H2C2_2 345..367 CDD:290200 8/24 (33%)
C2H2 Zn finger 358..378 CDD:275368 6/20 (30%)
zf-H2C2_2 370..394 CDD:290200 8/24 (33%)
C2H2 Zn finger 386..406 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.