DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG4424

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster

Alignment Length:395 Identity:90/396 (23%)
Similarity:135/396 (34%) Gaps:122/396 (31%)


  Fly   260 SLVD--ANLKATEARKDAKEE----EFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINM 318
            ||.|  .:|...:.|..||||    ...|.|..           .|.|        ...||:|..
  Fly    38 SLCDKIESLSGIQIRATAKEEVLPTRICLRCKA-----------FLTL--------AHKFRQICQ 83

  Fly   319 VGSDVVHTDNGEIYIINSASSE-------DQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEE 376
            ..::.:..     |:|..|..:       .|.:.|||.                  ....|:.|.
  Fly    84 RSNEFLRE-----YVIKDAVEQGVVKEVVQQTRPSTPP------------------PIETEQLEP 125

  Fly   377 IEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQT---PLKRKRSSELV-------FKQE 431
            .||.|:         |:.|:|..:.:           |:|   |.:::|.:.|.       :...
  Fly   126 PEDEVL---------EEGVWSTEDPI-----------EETPHGPAEKERPTVLTVEMLPAPYPPP 170

  Fly   432 SSCPQP-KTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCA 495
            :|.|.| ..|.:..  |...|.:|...:|.:..|..|...|      ......:|..|.......
  Fly   171 ASTPPPAPAGAVKG--KLHVCAICGNGYPRKSTLDTHMRRH------NDERPYECEICHKSFHVN 227

  Fly   496 SSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGR 560
            ..||||:..|||.||:.|..|:.:|:.|..|.:|..||...:.:.|..|...|...|.|:.|. :
  Fly   228 YQLKRHIRQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHY-K 291

  Fly   561 VHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQCGRQFNDRSAVQRHVTTMHKVKNKL 625
            .|.| .:.|.|.||::||..:..|..||.|                     |:|:.     ..:|
  Fly   292 THTG-EKPHICQLCNKSFARIHNLVAHLQT---------------------QQHIN-----DPRL 329

  Fly   626 TDYIS 630
            |.|:|
  Fly   330 TAYLS 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 22/76 (29%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 7/24 (29%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 9/20 (45%)
C2H2 Zn finger 598..617 CDD:275368 2/19 (11%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 16/78 (21%)
C2H2 Zn finger 189..209 CDD:275368 5/20 (25%)
DUF45 <204..281 CDD:302795 24/83 (29%)
COG5048 210..>345 CDD:227381 43/154 (28%)
C2H2 Zn finger 217..237 CDD:275368 6/20 (30%)
C2H2 Zn finger 245..265 CDD:275368 7/20 (35%)
zf-H2C2_2 257..282 CDD:290200 7/25 (28%)
C2H2 Zn finger 273..293 CDD:275368 6/21 (29%)
zf-H2C2_2 286..310 CDD:290200 10/26 (38%)
C2H2 Zn finger 301..320 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.