DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG17801

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster

Alignment Length:375 Identity:81/376 (22%)
Similarity:141/376 (38%) Gaps:76/376 (20%)


  Fly   288 PANNSDVN--------IDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQ 344
            |:..:|:|        |..:..:..:..|||.| .::....||:            ....:..:.
  Fly    54 PSCLNDLNTSIKLKKRIQRVHNEATLRRESGLD-EDLESTVSDI------------EPEGDSSDL 105

  Fly   345 DSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQ 409
            :|...:|.:|              :..:|..|..|:.: ||..|..:.:              ..
  Fly   106 ESEESYDSEN--------------YPFDKKAEESDIDL-NLAHEDRRNE--------------PH 141

  Fly   410 NDRDEQTPLKRKRSSELV----FKQES-----SCPQPKTG---------RITDTVKSFQCHLCPV 456
            |..|.:|||..|..:.|:    |..|:     ....||.|         |:..|..|.:. :.|:
  Fly   142 NPYDSETPLIFKHKNPLIETPSFANENLPNKVDAKSPKKGNFIQIGTDLRLLTTYPSIKV-VKPL 205

  Fly   457 AFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFS 521
            |...:.:..  .|.......:.|..:|.||.|........:||.||:.|||.|.|.|:.|:..|.
  Fly   206 ALAPEDVAA--ENVPPAKRTARKMQSLVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFV 268

  Fly   522 QREVLKRHMDT-HTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLS 585
            .:.:.:.|... |.|.:..:|..||:.|...:....|....|:.:.| ::|..|.:.||..:.|:
  Fly   269 TKYLARLHERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDLR-YQCDQCTKRFNTKTCLN 332

  Fly   586 RHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYISETNE 634
            :|...|:|:. |.|..|...|..::.::.|..::  ...|....|.|:.|
  Fly   333 KHKFLHSGLKPFDCVICQINFARKATLRSHFDSV--AHQKRASAILESEE 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 21/76 (28%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 4/21 (19%)
zf-H2C2_2 526..550 CDD:290200 7/25 (28%)
C2H2 Zn finger 541..562 CDD:275368 5/21 (24%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 4/19 (21%)
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 4/20 (20%)
zf-C2H2 231..252 CDD:278523 7/21 (33%)
C2H2 Zn finger 232..252 CDD:275368 7/20 (35%)
zf-H2C2_2 244..269 CDD:290200 12/25 (48%)
C2H2 Zn finger 260..281 CDD:275368 4/21 (19%)
C2H2 Zn finger 289..308 CDD:275368 5/19 (26%)
C2H2 Zn finger 318..338 CDD:275368 6/20 (30%)
C2H2 Zn finger 346..362 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.