DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG17802

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650659.2 Gene:CG17802 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster

Alignment Length:633 Identity:130/634 (21%)
Similarity:215/634 (34%) Gaps:233/634 (37%)


  Fly    14 CRLC--LKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATD--TLPKRICQECRYQLEKSFLFR 74
            ||||  |...|:...||||:    |..||.:|.|. ....||  .:|:.:|..|...|:.:..||
  Fly     5 CRLCGDLIYTQNPVNIFDEN----SKMVRQIALVT-GLWLTDHSKMPRNMCSCCLLSLKSAIAFR 64

  Fly    75 QRCQWAEKKLRKHIRLLGLGKRSRVFSK------DPDDYDEDELEFEDSIAFIEVQDKVRKLEDE 133
            |.|      ::.:.||. :.:|| |.:|      ||.....:.|:..|:....||..:|...::|
  Fly    65 QAC------IKTNNRL
T-IQRRS-VEAKDDGCWADPLSDAHEGLKINDAEVEQEVLYEVSYADNE 121

  Fly   134 KWREDF----KEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEV--RKELAEEVRSQVRD 192
            ...||.    |||:.:|:::                 .||. |::..|:  .||..|:.:.|..:
  Fly   122 GLEEDHDLYKKEEEESEVNE-----------------NKEF-EDIACEIPFSKEDDEQEQQQEYE 168

  Fly   193 DLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKR 257
            |                        :.:||.|.   .||.|    .|..|::.|           
  Fly   169 D------------------------MVDKKTGH---DDGEE----SQECEESQP----------- 191

  Fly   258 RPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSD 322
                                                        |||...::.||          
  Fly   192 --------------------------------------------DEEESQQNEED---------- 202

  Fly   323 VVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGE 387
                             |:::|:...|..|:         |||:.....:...:||.....:..:
  Fly   203 -----------------EEESQEDDDELWQN---------EDGDSDTDADSMSDIEATSRQSALD 241

  Fly   388 EISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCH 452
            |..:.::.::...:     .:.:|.|...|.|:||.:                            
  Fly   242 EDKKPRRKYTKRSS-----PKNDDTDFLKPAKKKRKT---------------------------- 273

  Fly   453 LCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECE 517
                 :.:||:       ||            |..|..:.:...:...|::.|:|:|||:|.||.
  Fly   274 -----YISQKV-------HI------------CDHCGKKFTDKGNFNLHVLRHSGVKPFECPECG 314

  Fly   518 LSFSQREVLKRHMDT-HTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRT---HKCHLCHRSF 578
            .....|.:|..|:.. |.|.|.:.|..|...|...:...:|..|||. |.:|   .||:.|.:.:
  Fly   315 QKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHR-NKKTPKNFKCNYCDKRY 378

  Fly   579 NHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKL 625
            ......::|.|.|.|.. |.|:.|...|...|.::.|..: .:.:|||
  Fly   379 ESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYRS-RQHQNKL 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 25/76 (33%)
vATP-synt_E 109..>244 CDD:304907 29/141 (21%)
RRF <161..222 CDD:294170 10/63 (16%)
zf-C2H2_8 454..530 CDD:292531 18/76 (24%)
C2H2 Zn finger 485..505 CDD:275368 3/20 (15%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 6/21 (29%)
zf-H2C2_2 526..550 CDD:290200 8/25 (32%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 4/20 (20%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 26/80 (33%)
C2H2 Zn finger 282..302 CDD:275368 3/20 (15%)
C2H2 Zn finger 310..331 CDD:275368 6/21 (29%)
C2H2 Zn finger 339..360 CDD:275368 6/21 (29%)
C2H2 Zn finger 371..388 CDD:275370 3/17 (18%)
zf-met 398..421 CDD:289631 5/24 (21%)
C2H2 Zn finger 399..417 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.