DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and pad

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650534.2 Gene:pad FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster

Alignment Length:868 Identity:147/869 (17%)
Similarity:285/869 (33%) Gaps:262/869 (30%)


  Fly    13 LCRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFLFRQRC 77
            |||:|.........|:..:....::..:::.|::|.....|.|||.:|.:|...:|:....|..|
  Fly    16 LCRICTDSSDHKTNIYSPEGRAKNLSQKILECLSLQIDEKDRLPKVVCAQCVQLVEQIHGLRATC 80

  Fly    78 QWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDS------------------IAFIEVQ 124
            :.::..|...:.:.......:::.:|..|.....|....|                  |..:.:|
  Fly    81 RNSQTMLNNCLNIRPAPSSDKLYIRDAVDETGKSLSVAQSAPPVPNGAQQSGNLLNSIIQAVNMQ 145

  Fly   125 DKVR------------------------KLEDEKWREDF---------------------KEEQA 144
            .:.:                        |.|.:...|:|                     |.:|.
  Fly   146 PQQQYTITMDNGVQQQQQQHQAMPEVQIKSERQTALEEFIRLKPDIKITPLGKKEPISPAKPQQQ 210

  Fly   145 AEMHKRLV-----KSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRK 204
            ..:..:.|     .::|:|:.:|..:| :.|.::::....::..:::.:|::...:..|::|...
  Fly   211 HSLQSQTVTPTINPTQLQLQPQLGDQL-QPLWQQIQQLQLQQQLQQLTNQLQATTQYSVAQDDTS 274

  Fly   205 EQLAMLLGELEVYLTEKKAGRWES----LDGSEPETKPQVKEDAS--------PSRSKTKAL--- 254
            ........:|...|:...|.::.:    ..||:|:.:.|:...:.        |::::..|.   
  Fly   275 SSGDSKKPKLNFVLSSPTAPQFTTSMPQFGGSQPQIQLQLMPGSGGVTSAGTVPAQTQLNAAALL 339

  Fly   255 -----PKRRPSLVDAN---LKATEARKDAKEEEFILGCNTD----PANNSD--------VNIDG- 298
                 |:...:|:..|   |..| .|.:..:::.:...:|.    |.....        ...|| 
  Fly   340 SSLAGPQSTTNLLSPNKCFLPIT-IRDENSDQQIVAHIDTKNLVLPTTYQVQMKLQPQLATADGQ 403

  Fly   299 -------------LELDEEVPAESGEDFR--------------------------EINMVGSDVV 324
                         |:|..:.....|..|:                          ...::.|...
  Fly   404 PIMQLTPTSIPATLQLTPQTLGNPGSAFQGTTVTQNQFLAPQQPLTQLPNTAQVTSQQIIRSPHT 468

  Fly   325 HTDNGEIYIIN----------SASSEDQNQDSTPEFDQ------------------DNGITSYNI 361
            .|.|.::.|.|          ..||:......||...|                  .||.::...
  Fly   469 STTNSQLVIRNVTNIPPTPTTPTSSKKAPTFKTPSPKQKPMPSPKSKTTVGPSSGGSNGTSTNEF 533

  Fly   362 KEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQ--------------------QVFSFHENVIIVE 406
            |.    ..:..||:           .::.|:|                    |..|.:..:..|.
  Fly   534 KR----LITQTKPQ-----------PQVKQQQTAGLSASGAPTATSANQAAMQRLSSNTTITKVP 583

  Fly   407 KEQNDRDEQTPLKRKRSSELVFKQ-------------------ESSCPQPKTGRITDTVKSF-QC 451
            |:........|........::.||                   .::.|.|.:..|..:|.:. |.
  Fly   584 KQPASLPAPAPTSNPAKLPMLNKQNITISRISMQTAPKAQSKPSTTSPTPASQPIPVSVPALSQA 648

  Fly   452 HLCPVAFPTQKLLTR-HHNTHIKGLK----------------SGKGGT-----------LKCPSC 488
            ...|:|...:|::.: ..|....|.|                .|:..|           |.||:|
  Fly   649 QPPPLAAQHKKIVRKPPENQDTSGQKVKAARPPQQILPSPQQEGQNATHSGSEAPTTSGLICPTC 713

  Fly   489 ALQLSCASSLKRHMIIHTGLKPFKCSE--CELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQK 551
            ..:......|.:|:.:|.||:||||||  |:.:||::|.|.||:.:|:|.|.:.|..|...|::|
  Fly   714 KREFKKKEHLTQHVKLHAGLRPFKCSEEGCDKTFSRKEHLSRHLVSHSGQKMYTCEVCKKPFSRK 778

  Fly   552 SNLQQHIGRVHMGNS--RTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQCGRQFNDRSA-VQR 613
            .||.:| .|:|...|  ..:.|.:|:::|.......:|...|..:.......|...:..:| ...
  Fly   779 DNLNKH-RRIHTQTSTETLYCCDVCNKNFATKLHYEKHREMHKKIRPESAAPGATASPAAAPALT 842

  Fly   614 HVTTMHKVKNKLTDYISETNEFQ 636
            ||.:..:|.||....|.:....|
  Fly   843 HVRSNGQVPNKAVFEIKQERSAQ 865

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 17/73 (23%)
vATP-synt_E 109..>244 CDD:304907 26/207 (13%)
RRF <161..222 CDD:294170 8/61 (13%)
zf-C2H2_8 454..530 CDD:292531 30/106 (28%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 14/27 (52%)
C2H2 Zn finger 513..533 CDD:275368 10/22 (45%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 4/20 (20%)
C2H2 Zn finger 598..617 CDD:275368 4/20 (20%)
padNP_650534.2 zf-AD 16..87 CDD:214871 16/71 (23%)
C2H2 Zn finger 710..730 CDD:275368 5/20 (25%)
zf-C2H2 736..760 CDD:278523 12/24 (50%)
C2H2 Zn finger 738..760 CDD:275368 10/22 (45%)
zf-H2C2_2 752..777 CDD:290200 9/25 (36%)
zf-C2H2 766..788 CDD:278523 8/23 (35%)
C2H2 Zn finger 768..788 CDD:275368 8/21 (38%)
zf-H2C2_2 780..808 CDD:290200 9/29 (31%)
C2H2 Zn finger 799..819 CDD:275368 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24377
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.