DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG6654

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster

Alignment Length:704 Identity:158/705 (22%)
Similarity:266/705 (38%) Gaps:152/705 (22%)


  Fly     9 DLATLCRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVA--------LDAKATDTLPKRICQECRY 65
            |:..:|..||.......:|:|....         :|:|        ...:..|.||:::|..|..
  Fly     2 DVDKICLTCLSSTGPLLSIYDGGSG---------SCLADMIREFTKTKPRRNDNLPEKVCLSCLS 57

  Fly    66 QLEKSFLFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKL 130
            ::...:.|:.:|:.:.:.||:.:        .....::||    .::.....:|..:...:....
  Fly    58 EISNCYTFKIKCENSSRTLRQLL--------PNALPEEPD----SKVSISCPVATTDQAVQTTSW 110

  Fly   131 EDEKWREDFKEEQA----AEMHKRLVKSRLELRAK-------LTTELRKELAEEVRS---EVRKE 181
            |.::.....:.:..    ||.:..|:||.:.:...       ...||..|..|:..|   :|:..
  Fly   111 EPDRCTASVQTDAVTTTDAEQNTSLIKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGN 175

  Fly   182 LAEE---VRSQVR-----DDLRNEVSEDIRKEQLAMLLG---ELEV----------------YLT 219
            |.:|   |.:|..     ||  :|:.:.||:..||:..|   |.|:                .||
  Fly   176 LKDEKEVVFTQTNVIYEGDD--HELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLT 238

  Fly   220 EKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKAT---EARKDAKEEEF- 280
            :::..:.::..||:.|.:...||....|..:|    .||..:|..::.||   :|....|:... 
  Fly   239 QQENDKHQTPVGSKEEARELEKEQVPQSAKRT----SRRRGVVKQDVPATPPSDAEPSPKQHRLG 299

  Fly   281 --------ILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVH-TDNGEI---YI 333
                    ..|....|:..|     |.....|:............:..|.::| ...|.|   |.
  Fly   300 TQRKLSAPRAGTVNGPSTTS-----GAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYK 359

  Fly   334 INSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVV----FNLGEEISQEQQ 394
            .|.......:.|...|....:|  ::|..|.|   ...:..|.:...:|    .||..:.:..|:
  Fly   360 CNECEKVFVSPDHLAEHQASHG--AHNCPECG---IRCDSKEALSKHMVQGHKRNLRNQCNICQK 419

  Fly   395 VFSFHENVIIVEKEQNDRDEQTPLKRKRSSE---------LVFKQESSCPQPKTGRITDTVKSFQ 450
            ||:....:         ||..    |..:.|         ..|.|.::..|.|. |.::| |||:
  Fly   420 VFTMLSTL---------RDHM----RIHTGEKPFVCNICGKSFTQNANLRQHKL-RHSET-KSFK 469

  Fly   451 CHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSE 515
            |.|||.:|.|:..||.|..|| .|.|     ..:|..|..:.:.:.||.:|...|||.:|:.|..
  Fly   470 CELCPHSFVTKAELTSHARTH-TGDK-----PFECEVCLARFTTSCSLAKHKRKHTGERPYACDL 528

  Fly   516 CELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNH 580
            |.:.|:...|||.|..||||.:.:.||.||..|.|:.:.|.| .|.|.| .|.:.|.:|:..|..
  Fly   529 CPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMH-QRTHQG-ERIYICPVCNEEFKS 591

  Fly   581 VSGLSRHLVTHAGVMFSCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYISETNE 634
            :..:..||            .|.:.:|:..|  |.|.:...:|.......|.||
  Fly   592 MPEMRSHL------------AGHEQHDKRLV--HFTFLSNKENGSGALEEELNE 631

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 16/81 (20%)
vATP-synt_E 109..>244 CDD:304907 34/176 (19%)
RRF <161..222 CDD:294170 22/98 (22%)
zf-C2H2_8 454..530 CDD:292531 27/76 (36%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 9/21 (43%)
C2H2 Zn finger 571..591 CDD:275368 5/20 (25%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 16/82 (20%)
C2H2 Zn finger 331..354 CDD:275368 3/23 (13%)
COG5048 <357..570 CDD:227381 68/239 (28%)
C2H2 Zn finger 360..380 CDD:275368 3/20 (15%)
C2H2 Zn finger 385..406 CDD:275370 4/24 (17%)
C2H2 Zn finger 414..434 CDD:275368 6/33 (18%)
zf-H2C2_2 427..451 CDD:290200 5/37 (14%)
C2H2 Zn finger 442..490 CDD:275368 19/50 (38%)
C2H2 Zn finger 470..487 CDD:275368 9/17 (53%)
zf-H2C2_2 482..507 CDD:290200 9/31 (29%)
C2H2 Zn finger 498..518 CDD:275368 5/20 (25%)
zf-H2C2_2 510..534 CDD:290200 10/24 (42%)
C2H2 Zn finger 526..546 CDD:275368 8/20 (40%)
zf-H2C2_2 539..563 CDD:290200 12/24 (50%)
C2H2 Zn finger 554..574 CDD:275368 9/21 (43%)
C2H2 Zn finger 582..602 CDD:275368 6/32 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.