DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp950

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001296145.1 Gene:Zfp950 MGIID:2652824 Length:609 Species:Mus musculus

Alignment Length:504 Identity:126/505 (25%)
Similarity:187/505 (37%) Gaps:146/505 (29%)


  Fly   208 AMLLGELEVYLTEKKAGRWESLDGSEP--------ET------------KPQVKEDASPSRSKTK 252
            |:...|:.|..|:::   |..||.|:.        ||            ...::|....||...:
Mouse     3 AVTYDEVHVNFTQEE---WALLDHSQKSLYRDVMLETYKNLTAIGYNWDDHNIEEHCQSSRRHGR 64

  Fly   253 ---ALPKRRPSLVDANLKATEARKDAKEEEFI------LGCNTDPANNSDVNIDGLELDEEVPAE 308
               :.|..:||......||.......:..|.|      .|||  ....:..:...|:..|.:  .
Mouse    65 HETSHPGEKPSQYTHCGKAFVYWSHPQRHERIHTGEKPYGCN--HCGKAFAHHSNLQRHERI--H 125

  Fly   309 SGEDFREINMVG-SDVVHTD--------NGE------------IYIINSASSEDQNQDSTP-EFD 351
            :||...|.|..| :.|.|:|        .||            .|..|....|..:....| |.:
Mouse   126 TGEKPYECNQCGKAFVTHSDLQIHKRTHTGEKPYECNQCGKAFAYHSNLQRHERIHTGEKPYECN 190

  Fly   352 QDNGITSY--NIKEDGEIQFSGEKPEE-------------IEDVVVFNLGE---EISQEQQVFSF 398
            |.....:|  |::....|. :||||.|             ::...:.:.||   |.:|..:.|:.
Mouse   191 QCGKAFAYHSNLQRHERIH-TGEKPYECNKCGKAFAWHSHLQRHEITHTGEKPYECNQCGKAFAH 254

  Fly   399 HENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKL 463
            ..|:.|             .|||.:.|                     |.::|:.|..|||...|
Mouse   255 DSNLHI-------------HKRKHAGE---------------------KPYECNQCGKAFPCYNL 285

  Fly   464 LTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKR 528
            |..|..|| .|.|     ..:|..|....:..|.|:.|..||||.||::|:.|..:|||...|:.
Mouse   286 LQIHKRTH-TGEK-----PYECNQCGKTFAYHSYLQMHERIHTGEKPYECNHCGKAFSQHSSLRV 344

  Fly   529 HMDTHTGVKRHQCPQCSSCFAQKSNLQ----QHIG-----------------------RVHMGNS 566
            |..||||.|.::|.||...|...|:||    .|.|                       |:|.| .
Mouse   345 HKRTHTGEKPYECNQCGEAFVYHSHLQIHKTMHTGEKPFQCNQCDKAFVYNNHLLVHKRIHTG-E 408

  Fly   567 RTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614
            :.::|:.|.::|:.:|||..|..||.|.. :.|.:||:.|...|.:|||
Mouse   409 KPYECNHCGKAFSQLSGLHVHKRTHTGEKPYKCNECGKAFARNSHLQRH 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 11/56 (20%)
RRF <161..222 CDD:294170 4/14 (29%)
zf-C2H2_8 454..530 CDD:292531 29/76 (38%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 11/24 (46%)
C2H2 Zn finger 541..562 CDD:275368 10/48 (21%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 8/18 (44%)
Zfp950NP_001296145.1 KRAB 4..>45 CDD:214630 9/44 (20%)
KRAB 4..43 CDD:279668 9/42 (21%)
C2H2 Zn finger 78..97 CDD:275368 4/19 (21%)
COG5048 101..514 CDD:227381 106/404 (26%)
C2H2 Zn finger 105..125 CDD:275368 4/24 (17%)
zf-H2C2_2 117..142 CDD:290200 8/27 (30%)
C2H2 Zn finger 133..153 CDD:275368 5/20 (25%)
zf-H2C2_2 145..170 CDD:290200 3/25 (12%)
C2H2 Zn finger 161..181 CDD:275368 3/20 (15%)
zf-H2C2_2 173..198 CDD:290200 5/25 (20%)
C2H2 Zn finger 189..209 CDD:275368 4/20 (20%)
zf-H2C2_2 201..225 CDD:290200 7/25 (28%)
C2H2 Zn finger 217..237 CDD:275368 0/20 (0%)
zf-H2C2_2 229..254 CDD:290200 5/25 (20%)
C2H2 Zn finger 245..265 CDD:275368 7/33 (21%)
C2H2 Zn finger 273..293 CDD:275368 9/20 (45%)
zf-H2C2_2 286..310 CDD:290200 8/30 (27%)
C2H2 Zn finger 301..321 CDD:275368 6/20 (30%)
zf-H2C2_2 313..338 CDD:290200 12/25 (48%)
C2H2 Zn finger 329..349 CDD:275368 8/20 (40%)
zf-H2C2_2 341..366 CDD:290200 11/25 (44%)
C2H2 Zn finger 357..377 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368 1/20 (5%)
zf-H2C2_2 397..422 CDD:290200 6/26 (23%)
C2H2 Zn finger 413..433 CDD:275368 8/20 (40%)
zf-H2C2_2 428..450 CDD:290200 8/22 (36%)
C2H2 Zn finger 441..461 CDD:275368 8/18 (44%)
zf-H2C2_2 453..478 CDD:290200 3/6 (50%)
C2H2 Zn finger 469..489 CDD:275368
C2H2 Zn finger 497..517 CDD:275368
C2H2 Zn finger 525..545 CDD:275368
C2H2 Zn finger 553..573 CDD:275368
C2H2 Zn finger 581..601 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.