DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG6813

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster

Alignment Length:291 Identity:78/292 (27%)
Similarity:119/292 (41%) Gaps:49/292 (17%)


  Fly   370 SGEKPEEIEDV--VVFNLGEEISQE---------QQVFSFHENVIIVEKEQNDRDE-------QT 416
            :|....:|..:  |..:..:|||.:         |....|.:..||.||:..:|.|       ..
  Fly    23 NGHLVRQIHSITGVELSCKKEISGQMCTTCLDNLQAAIKFRQRCIIAEKQNLERIECDSKDCSTD 87

  Fly   417 PL------KRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGL 475
            |:      ..:..|||  .:...||:.|...:....|        |:.||..       .|.|.:
  Fly    88 PIIYEDIDDNQIESEL--DESILCPEVKDLPMPSAEK--------VSAPTSL-------NHQKSI 135

  Fly   476 KSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKC--SECELSFSQREVLKRHMDTHTGVKR 538
            ..|.|..: ||.|...::..|:.:.|.:.|||:|.|.|  ..||.||:.|:.|..|...|||.:.
  Fly   136 GGGTGPYV-CPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQP 199

  Fly   539 HQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCG 602
            :.|..|...|:.....|:| .|.|. |.|.::|..|.:||.....|.:|.:.|.... ..|..|.
  Fly   200 YVCVYCPRRFSSSGARQEH-HRRHR-NERRYECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQ 262

  Fly   603 RQFNDRSAVQRHVTT-MHKVK-NKLTDYISE 631
            :.|...|.:..|::: :||.| .|||:...|
  Fly   263 KHFKRISHLMTHLSSNIHKRKEEKLTELAIE 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/78 (32%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 11/27 (41%)
C2H2 Zn finger 513..533 CDD:275368 8/22 (36%)
zf-H2C2_2 526..550 CDD:290200 8/24 (33%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 12/53 (23%)
C2H2 Zn finger 144..164 CDD:275368 5/20 (25%)
C2H2 Zn finger 172..194 CDD:275368 8/22 (36%)
zf-H2C2_2 186..211 CDD:290200 8/25 (32%)
UFD2 <256..>294 CDD:227443 12/39 (31%)
C2H2 Zn finger 258..280 CDD:275368 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.