DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG14711

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster

Alignment Length:582 Identity:119/583 (20%)
Similarity:184/583 (32%) Gaps:227/583 (39%)


  Fly     5 PSYPDLATLCRLCLKE--HQDAYA-IFDEDDTQLSIPVRLMACV-ALDAKATDTLPKRICQECRY 65
            |.|    .|||:||.|  :.:|.| :||::|.|....||.:..| ::.......:|..:|..|..
  Fly     2 PEY----MLCRICLTEDINSEAMAPLFDDNDAQCRELVRKIEEVGSIKLVPLQNIPSMLCYSCVE 62

  Fly    66 QLEKSFLFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKL 130
            :|..:..||:.||.:|                |.|:.:                           
  Fly    63 RLTSAHKFRELCQESE----------------RTFATN--------------------------- 84

  Fly   131 EDEKWREDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLR 195
                                :||:  |::::.|.|:...:|:.:  |...|.|.:....|.||:.
  Fly    85 --------------------VVKA--EMKSEPTDEVPHVVADNI--EYIYESANDFIDGVEDDIG 125

  Fly   196 NEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPS 260
               .|:|.:|.|...:||                                               
  Fly   126 ---MENIMEEPLEDGVGE----------------------------------------------- 140

  Fly   261 LVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEE---VPAESGEDFREINMVGSD 322
                                     |..|..:...:|  :|||:   ||..:..|::.|......
  Fly   141 -------------------------TSQAYETSTVVD--DLDEDDLLVPNSTDSDYQPIERCRKA 178

  Fly   323 VVH----TDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVF 383
            .|.    |..|.                    .:..|.:|.:.:     .||.|:|..   ...|
  Fly   179 KVRKTRMTKRGR--------------------GRPRGASSGHPR-----SFSEERPPV---QASF 215

  Fly   384 NLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKS 448
            ....|:|....:.....|:.                .||::..:..:.....:|           
  Fly   216 KSSPEVSSTNIMCEICGNIY----------------SKRAALNIHMRRHMAEKP----------- 253

  Fly   449 FQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKC 513
            |:|.:|..:|.....|.||...|     :|:...| |..|....:..||..||...||..:||.|
  Fly   254 FKCEICSKSFAGPSELNRHIRVH-----TGEKPFL-CKYCNRSFADRSSNIRHERTHTNERPFTC 312

  Fly   514 SECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGR-------VHMGNSRT 568
            |.|..:||...|||.||.||||.|...|..|:..|::|..|.||:|.       :|..|.||
  Fly   313 STCGKAFSYSNVLKNHMLTHTGEKPFLCRVCNKTFSRKHQLDQHLGTMTHQQTVIHHKNERT 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 24/77 (31%)
vATP-synt_E 109..>244 CDD:304907 18/135 (13%)
RRF <161..222 CDD:294170 15/61 (25%)
zf-C2H2_8 454..530 CDD:292531 27/76 (36%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 12/25 (48%)
C2H2 Zn finger 513..533 CDD:275368 11/20 (55%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 8/28 (29%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
CG14711NP_650094.1 zf-AD 6..81 CDD:285071 25/91 (27%)
C2H2 Zn finger 228..248 CDD:275368 3/36 (8%)
zf-H2C2_2 240..264 CDD:290200 5/35 (14%)
COG5048 249..>362 CDD:227381 44/130 (34%)
C2H2 Zn finger 256..276 CDD:275368 6/20 (30%)
zf-H2C2_2 268..292 CDD:290200 8/30 (27%)
C2H2 Zn finger 284..304 CDD:275368 6/20 (30%)
zf-H2C2_2 299..321 CDD:290200 11/22 (50%)
C2H2 Zn finger 312..332 CDD:275368 11/20 (55%)
zf-H2C2_2 325..349 CDD:290200 12/24 (50%)
C2H2 Zn finger 340..362 CDD:275368 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.