DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG14710

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster

Alignment Length:639 Identity:128/640 (20%)
Similarity:201/640 (31%) Gaps:255/640 (40%)


  Fly    14 CRLCLKEHQDAYAIF---DEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFLFRQ 75
            ||:||.:.:::..|.   |:.::.|.  .:|..|..:..:.:..||::.|..|...::..|.|||
  Fly    10 CRICLGDFEESQMICLFGDKGESDLR--KKLELCCRIRVRQSPQLPEKACNSCCEFVQMWFNFRQ 72

  Fly    76 RCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFK 140
            .|                 ..|:|:                                  |     
  Fly    73 MC-----------------LNSQVY----------------------------------W----- 81

  Fly   141 EEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKE 205
                                                                    |.|...|.|
  Fly    82 --------------------------------------------------------ETSSSERPE 90

  Fly   206 QLAMLL-GELEVYLTEK---KAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANL 266
            .||... .|..:||.|.   |.|           |:.|.||:                  :.|..
  Fly    91 ALAQASDAEYMLYLYENLHLKLG-----------TENQEKEE------------------ITAIE 126

  Fly   267 KATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEI 331
            :..|.::|..:|  :|..|....|.|      :|.|||...||.|...        :.|.|:   
  Fly   127 EGDEQQEDQSQE--VLDFNGFIINES------IEEDEEPNTESPEQIL--------ISHMDS--- 172

  Fly   332 YIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVF---NLGEEISQEQ 393
            |:      :||..:..                   |...||..||:.:...|   ..|:|.....
  Fly   173 YV------DDQQMEEL-------------------IDDKGELVEELSNANTFYEVEYGDEELLMS 212

  Fly   394 QVFSFHENVIIVEKEQNDRDEQTPLK-RKRSSELVFKQ-----ESSCPQPKTGRITDTVKSFQCH 452
            ...|.|.:.        ..|:|.|.: ||..:||.||:     :....|||    ....:.|.|.
  Fly   213 SAPSPHPSF--------KMDKQKPGRPRKPDAELKFKRKDINAKERGNQPK----CKEEEKFMCI 265

  Fly   453 LCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECE 517
            ||...|..:.:.|                                  .||:.|:..||.:|..|.
  Fly   266 LCGNVFYKKSVFT----------------------------------AHMMTHSEYKPHQCEICN 296

  Fly   518 LSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVS 582
            .||.|...|:.|:..|||.:.::|..|...|..:|...:| .|||. |:|.:.|..|.::|.|.:
  Fly   297 KSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRH-ERVHT-NTRPYACQECGKTFTHTA 359

  Fly   583 GLSRHLVTH-AGVMFSCKQCGRQFNDRSAVQRHVTTM-HKVKNKLTDYISETNE 634
            .|..|:::| |...::|..|.:.|.....::.|:.|: |  :||:...|..:.|
  Fly   360 ILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTH--RNKMEQTIPSSPE 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 18/75 (24%)
vATP-synt_E 109..>244 CDD:304907 17/139 (12%)
RRF <161..222 CDD:294170 10/65 (15%)
zf-C2H2_8 454..530 CDD:292531 15/76 (20%)
C2H2 Zn finger 485..505 CDD:275368 2/20 (10%)
zf-H2C2_2 497..522 CDD:290200 9/25 (36%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 8/24 (33%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 4/19 (21%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 22/187 (12%)
COG5048 <261..395 CDD:227381 43/170 (25%)
C2H2 Zn finger 264..284 CDD:275368 7/54 (13%)
zf-C2H2 290..312 CDD:278523 7/22 (32%)
C2H2 Zn finger 292..312 CDD:275368 7/20 (35%)
zf-H2C2_2 304..327 CDD:290200 7/23 (30%)
C2H2 Zn finger 320..340 CDD:275368 7/21 (33%)
zf-H2C2_2 335..357 CDD:290200 9/24 (38%)
C2H2 Zn finger 348..368 CDD:275368 6/20 (30%)
C2H2 Zn finger 376..395 CDD:275368 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C264224472
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.