DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and M1BP

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster

Alignment Length:644 Identity:124/645 (19%)
Similarity:196/645 (30%) Gaps:269/645 (42%)


  Fly    10 LATLCRLCLK--EHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFL 72
            |.:.||:|.|  .::.:..:|:..:|::...:.  |...|..:....||.:||:.|..:|..:..
  Fly     9 LKSTCRVCAKYASNKRSPKLFERSNTKMIDNIE--ALTGLRLENYGCLPDQICECCSMELASAVK 71

  Fly    73 FRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWRE 137
            .|:||..|:::|     |||                                             
  Fly    72 LRERCIAAQREL-----LLG--------------------------------------------- 86

  Fly   138 DFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVR---DDLRNEVS 199
                                    ||.|.|:.::...|:.|   :.|::...|:   ||      
  Fly    87 ------------------------LTEEQRQGISAFYRAAV---MGEDIVQTVKTPDDD------ 118

  Fly   200 EDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDA 264
                           |||.|      ::.:...||                              
  Fly   119 ---------------EVYAT------YQEIVLEEP------------------------------ 132

  Fly   265 NLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELD------EEVPAESGEDFREINMVGSDV 323
                       |||                 ||..:::      |.....:|||     ...|.:
  Fly   133 -----------KEE-----------------IDDTKVEYDNTYYEVAEGHAGED-----DAASLI 164

  Fly   324 VHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEE 388
            ...|      .:|..:||:.|..|.|.|:|..:.                ..::.|..|::..:|
  Fly   165 EEAD------YDSIMAEDEEQQQTLELDEDTELI----------------VGDVNDAYVYDSDDE 207

  Fly   389 ISQEQQVFS---FHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKT----GRITDTV 446
            ::....|..   .|||:::                        |:.|..|:||.    .|...|.
  Fly   208 VAVLDNVLDDEYEHENIVV------------------------KKCSLPPKPKVRSDDARRRGTG 248

  Fly   447 KSFQCHLCPVAFPTQKLLTRHHNTHIKG-------LKSGKGG-TLKCPSCALQLSCASSLKRHMI 503
            ..:.|..|              ..||||       .:..:|. ...|..|..:....|.|||||.
  Fly   249 GVYICEQC--------------GNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMR 299

  Fly   504 IHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRT 568
            .|||.:||.|..|...|:......:|..|||..:.:.|..|...|.....|:.|: .:|.| .|.
  Fly   300 KHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHM-LIHSG-ERA 362

  Fly   569 HKCHLCHRSFNHVSGLSRHLVTH--AGV------MFSCKQCGRQFNDRSAVQRHVTTMH 619
            ::|.||.:||.    |..||.||  :||      ....||...|...|...:....::|
  Fly   363 YRCELCDKSFM----LPTHLSTHFRSGVHKRHLEKAEMKQVLEQEQKRELKEEEEDSLH 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 19/75 (25%)
vATP-synt_E 109..>244 CDD:304907 16/138 (12%)
RRF <161..222 CDD:294170 14/64 (22%)
zf-C2H2_8 454..530 CDD:292531 23/84 (27%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 13/25 (52%)
C2H2 Zn finger 513..533 CDD:275368 5/20 (25%)
zf-H2C2_2 526..550 CDD:290200 7/24 (29%)
C2H2 Zn finger 541..562 CDD:275368 5/21 (24%)
C2H2 Zn finger 571..591 CDD:275368 9/20 (45%)
C2H2 Zn finger 598..617 CDD:275368 4/19 (21%)
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 19/78 (24%)
C2H2 Zn finger 253..273 CDD:275368 6/34 (18%)
COG5048 276..>331 CDD:227381 20/55 (36%)
C2H2 Zn finger 281..301 CDD:275368 8/20 (40%)
zf-H2C2_2 293..317 CDD:290200 13/24 (54%)
C2H2 Zn finger 309..329 CDD:275368 5/20 (25%)
zf-H2C2_2 324..346 CDD:290200 7/22 (32%)
C2H2 Zn finger 337..357 CDD:275368 5/21 (24%)
zf-H2C2_2 350..372 CDD:290200 9/24 (38%)
C2H2 Zn finger 365..383 CDD:275368 10/22 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.