DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and ouib

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster

Alignment Length:327 Identity:75/328 (23%)
Similarity:127/328 (39%) Gaps:70/328 (21%)


  Fly   296 IDGLELD--EEVPA----------ESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTP 348
            |.||.|.  ::||.          .|...||::      .:.|....:.|.:.:||.|::.:...
  Fly    36 ISGLRLVDLDDVPGFMCLCCQAELRSALAFRKL------CIKTQTKWLTIEDDSSSGDEDTNDNS 94

  Fly   349 EFDQDN-GITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDR 412
            |.:.:. ..:.:..|::||                  |.||..|           :::|:|..|:
  Fly    95 ELESEKCAFSDFGKKKEGE------------------LVEETFQ-----------VLIEEEPMDK 130

  Fly   413 DEQTPLKRKRSSELVFKQESSCPQPKTGRITDTV--KSFQCHLCPVAFPTQKLLTRHHNTHIKGL 475
            ......|.:...:.:  .|...|..|..:::..:  :.:.|.||.....::....||...| :|.
  Fly   131 TLNRDAKAQLREDGI--DEKCVPSQKIIKVSTKLDDQIYICELCGTHATSKPTFQRHMRKH-RGE 192

  Fly   476 KSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECE---LSFSQREVLKRHMDTHTGVK 537
            :     ...|..|..:...|..|:.|..:|||.:||.|..||   :|:..|.:   |..|||..:
  Fly   193 R-----PFGCKDCDARFLSAGELRAHHRVHTGEQPFACRFCEKRYVSYMGRLI---HERTHTNDR 249

  Fly   538 RHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQCG 602
            .:.|.:|...|.....|:.|: .:|.| .|..:|.:|.|||..    ..|||||...|...:...
  Fly   250 PYVCEECGKKFTTAYVLKNHM-VIHTG-ERNFRCDICDRSFQR----KAHLVTHTRSMMHLQNVK 308

  Fly   603 RQ 604
            :|
  Fly   309 KQ 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 21/79 (27%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 11/28 (39%)
C2H2 Zn finger 513..533 CDD:275368 7/23 (30%)
zf-H2C2_2 526..550 CDD:290200 7/24 (29%)
C2H2 Zn finger 541..562 CDD:275368 5/21 (24%)
C2H2 Zn finger 571..591 CDD:275368 9/20 (45%)
C2H2 Zn finger 598..617 CDD:275368 1/8 (13%)
ouibNP_649822.2 zf-AD 5..78 CDD:214871 10/48 (21%)
COG5048 <158..300 CDD:227381 44/157 (28%)
C2H2 Zn finger 169..189 CDD:275368 5/20 (25%)
C2H2 Zn finger 197..217 CDD:275368 5/20 (25%)
zf-H2C2_2 209..234 CDD:290200 10/25 (40%)
C2H2 Zn finger 225..245 CDD:275368 7/23 (30%)
zf-H2C2_2 241..262 CDD:290200 7/21 (33%)
C2H2 Zn finger 253..273 CDD:275368 5/21 (24%)
zf-H2C2_2 266..288 CDD:290200 9/24 (38%)
C2H2 Zn finger 281..299 CDD:275368 10/22 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.