DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp874b

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006517346.1 Gene:Zfp874b MGIID:3040702 Length:451 Species:Mus musculus

Alignment Length:254 Identity:76/255 (30%)
Similarity:119/255 (47%) Gaps:30/255 (12%)


  Fly   370 SGEKPEEIEDV-VVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESS 433
            :||||.:.|:. ..|.....:.|.|::.|         .|:.|:.|:  ..:..||.....|...
Mouse   219 TGEKPYKCEECGNSFYYPAMLKQHQRIHS---------GEKLDKCEE--CGKVFSSAFFLNQHKG 272

  Fly   434 CPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSL 498
                    |....|.::|..|..:|..:..|..|:..|     ||: ...||..|....|.:|.|
Mouse   273 --------IDSIEKRYKCQECGKSFCYRSYLREHYRRH-----SGE-YPYKCEECGKGFSRSSKL 323

  Fly   499 KRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHM 563
            :.|..||||:||:||.|||..||....||||...|:....|:|.:|...|:..|.||:| .::|.
Mouse   324 QEHQTIHTGVKPYKCEECEKCFSSFTSLKRHQIIHSEDTPHECVECGKRFSSSSRLQEH-QKIHT 387

  Fly   564 GNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKV 621
             ..:.:||..|.::|.:.|.|.||...|.... ::|::||:.:...::::|| .|:|.|
Mouse   388 -EEKPYKCEECDKAFLYHSFLRRHRAVHTREKPYTCEECGKCYTSFTSLKRH-QTIHSV 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 31/76 (41%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 15/25 (60%)
C2H2 Zn finger 513..533 CDD:275368 10/20 (50%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
Zfp874bXP_006517346.1 KRAB 9..63 CDD:214630
KRAB 9..48 CDD:279668
C2H2 Zn finger 115..134 CDD:275368
C2H2 Zn finger 142..162 CDD:275368
COG5048 <147..427 CDD:227381 71/235 (30%)
C2H2 Zn finger 170..190 CDD:275368
zf-H2C2_2 182..207 CDD:290200
C2H2 Zn finger 198..218 CDD:275368
zf-H2C2_2 210..235 CDD:290200 6/16 (38%)
C2H2 Zn finger 226..246 CDD:275368 4/20 (20%)
C2H2 Zn finger 254..274 CDD:275368 5/30 (17%)
C2H2 Zn finger 282..302 CDD:275368 5/20 (25%)
zf-H2C2_2 294..319 CDD:290200 9/31 (29%)
C2H2 Zn finger 310..330 CDD:275368 7/20 (35%)
C2H2 Zn finger 338..358 CDD:275368 10/20 (50%)
C2H2 Zn finger 366..386 CDD:275368 7/21 (33%)
zf-H2C2_2 379..403 CDD:290200 8/26 (31%)
C2H2 Zn finger 394..414 CDD:275368 7/20 (35%)
C2H2 Zn finger 422..442 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.