DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Zfp873

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001306132.1 Gene:Zfp873 MGIID:3040689 Length:667 Species:Mus musculus

Alignment Length:500 Identity:119/500 (24%)
Similarity:179/500 (36%) Gaps:131/500 (26%)


  Fly   208 AMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEAR 272
            |:...::.|..|.::   |..||.|:   |...|:....:.....|:..|   |.|.|:: ...:
Mouse     3 AVTYEDVHVNFTHEE---WALLDSSQ---KSLYKDVMLETCRNLTAIGYR---LEDHNIE-EHCQ 57

  Fly   273 KDAKEEEFILGCNTDPANNSDVNIDG-----------LELDEEVPAESGEDFREINMVGSDVV-- 324
            ...:...:|..|...|..|.|   .|           |::.|.:..|  |...|.|......|  
Mouse    58 SSRRPGRYICNCGYKPCENED---HGKKQCSFACNSFLQMYERIYNE--EKAYECNQYSKAFVNF 117

  Fly   325 -----HTDN------------GEIYIINSASSEDQNQDSTPE-----------FDQDNGITS--- 358
                 |..|            |:.|:  |.||:...:....|           |:.||.:.:   
Mouse   118 HSLPQHAKNHPREQPYECNHCGKAYV--SPSSQIHKRSHVGEKPYECSKCGKAFENDNHLQNREK 180

  Fly   359 -------YNIKEDGEIQFS------------GEKPEEIEDVVVFNLGEEISQEQQVFSFHENVII 404
                   :...:.|:...|            ||||.|..     ..|:..: .:.....|::|..
Mouse   181 HHTLEKLFECSQCGKAFASRSYLPIHRRIHTGEKPYECT-----QCGKAFT-SRSYLKIHKSVHT 239

  Fly   405 VEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHN 469
            .||         |.:..:.|: .|....|..|.:.....:  |.::|..|..|||:...|..|..
Mouse   240 GEK---------PYECNQCSK-AFANFYSLRQHEKYHTRE--KPYECSHCSKAFPSPSSLQVHER 292

  Fly   470 THIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHT 534
            || .|.|     ...|..|.......|||:.|..:|||.||::|:.|..:|..|..|:.|...||
Mouse   293 TH-TGEK-----PYDCTECGKAFISHSSLQIHKRVHTGEKPYECTLCGKAFVNRSYLEVHKRIHT 351

  Fly   535 GVKRHQCPQCSSCFAQKSNLQQH-------------------IGRVHMG-NSRTH------KCHL 573
            |.|.::|.|||..||...:|:||                   :...|:. :.|||      .|..
Mouse   352 GEKPYECSQCSKAFANFRSLRQHEKNHTREKPYECSQCSKAFVSPCHLQIHQRTHTGEKPYDCSD 416

  Fly   574 CHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTT 617
            |.::|..:|.|..|..||.|.. :.|.|||:.|...|.:|.|..|
Mouse   417 CGKAFTRLSNLQVHKRTHTGQKPYCCSQCGKAFPCFSNLQIHERT 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 9/36 (25%)
RRF <161..222 CDD:294170 3/14 (21%)
zf-C2H2_8 454..530 CDD:292531 27/76 (36%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 12/24 (50%)
C2H2 Zn finger 541..562 CDD:275368 9/40 (23%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 8/19 (42%)
Zfp873NP_001306132.1 KRAB 4..>45 CDD:214630 9/47 (19%)
KRAB 4..43 CDD:279668 9/45 (20%)
C2H2 Zn finger 107..127 CDD:275368 4/20 (20%)
C2H2 Zn finger 135..154 CDD:275368 5/21 (24%)
COG5048 158..573 CDD:227381 84/328 (26%)
C2H2 Zn finger 162..182 CDD:275368 3/20 (15%)
C2H2 Zn finger 190..210 CDD:275368 2/20 (10%)
zf-H2C2_2 206..227 CDD:290200 6/27 (22%)
C2H2 Zn finger 218..238 CDD:275368 3/26 (12%)
C2H2 Zn finger 246..266 CDD:275368 4/21 (19%)
C2H2 Zn finger 274..294 CDD:275368 8/20 (40%)
zf-H2C2_2 286..309 CDD:290200 8/29 (28%)
C2H2 Zn finger 302..322 CDD:275368 6/20 (30%)
zf-H2C2_2 314..339 CDD:290200 11/25 (44%)
C2H2 Zn finger 330..350 CDD:275368 6/20 (30%)
zf-H2C2_2 342..367 CDD:290200 12/25 (48%)
C2H2 Zn finger 358..378 CDD:275368 9/20 (45%)
zf-H2C2_2 370..395 CDD:290200 3/25 (12%)
C2H2 Zn finger 386..406 CDD:275368 3/20 (15%)
zf-H2C2_2 398..423 CDD:290200 7/25 (28%)
C2H2 Zn finger 414..434 CDD:275368 7/20 (35%)
zf-H2C2_2 426..449 CDD:290200 9/23 (39%)
C2H2 Zn finger 442..462 CDD:275368 9/20 (45%)
zf-H2C2_2 454..479 CDD:290200 3/8 (38%)
C2H2 Zn finger 470..490 CDD:275368
C2H2 Zn finger 498..518 CDD:275368
zf-H2C2_2 510..535 CDD:290200
C2H2 Zn finger 526..546 CDD:275368
zf-H2C2_2 538..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
zf-H2C2_2 595..619 CDD:290200
C2H2 Zn finger 610..630 CDD:275368
C2H2 Zn finger 638..656 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.