DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb1

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_999962.1 Gene:zbtb1 ZFINID:ZDB-GENE-041001-126 Length:677 Species:Danio rerio

Alignment Length:524 Identity:104/525 (20%)
Similarity:186/525 (35%) Gaps:129/525 (25%)


  Fly   165 ELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESL 229
            :|||..:.  ||...||.....|:...||.....|       ...||.|..:..|.:||.:    
Zfish   210 DLRKRTSG--RSSAMKERPRFGRTYTCDDCGFVFS-------CEKLLIEHILTCTNRKAFQ---- 261

  Fly   230 DGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEARKDAKEE-EFIL-----GCNTDP 288
               .|:...:|..|...:.|.|......:.:|    .|..:...|.|.: |.::     |..::.
Zfish   262 ---TPKVSKEVYSDNGKAESSTSEGTDEQRTL----CKGEDEWSDHKPDMETVIRSVASGMESEN 319

  Fly   289 ANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQD 353
            |.:.::.|. :|.|:    :|..|...|.:|  .|.:.:.|...:...|..::.......:.::|
Zfish   320 AFSRNITIK-VERDD----DSETDLETIKVV--KVGNLNLGSCKVRTRAFKDNLADQIKFDSEED 377

  Fly   354 NGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEE---------------ISQEQQVFSFHEN-- 401
            .|:::.:..|       |:..|...|:.|..:.||               :::|:|...:..|  
Zfish   378 PGVSAMDALE-------GKSTELDTDLKVHRIKEEKQDGTCIPCELCGALLTEEEQSAHYISNHM 435

  Fly   402 -----------VIIVEKEQNDRDEQ------TPLKRKRSSELVFKQESSCPQPKTGRITDTVKSF 449
                       |:|..::..:..|:      |.:.......|:.:...:..:   ..:......|
Zfish   436 GHICACGRCGQVLIKGRQLQEHAERCGEPQGTEMDSPGEDSLLLEDAEAMEE---NLLEGADLGF 497

  Fly   450 QCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPS----------------------CALQL 492
            :|.||.:.|.::.|...|              ||.||.                      ||:  
Zfish   498 RCPLCGLIFESESLAVEH--------------TLACPEQEPFRPVMLEDGGEPDHRRKHFCAI-- 546

  Fly   493 SCASS------LKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQC-SSCFAQ 550
             |...      |:.|..:||..|.|.|..|...|.:...|:.|.|.|.|:.|:.||.| ...|.:
Zfish   547 -CGKGFYQRCHLREHYTVHTKEKQFTCQTCGKQFLRERQLRLHTDMHKGMARYVCPVCDQGTFLK 610

  Fly   551 KSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQCGRQFNDRSAVQRHV 615
            ..:::..|..:..|.:   .|.:|.:.|.....|.:|:..|   ::.|..||.:|..|..::.|.
Zfish   611 HDHVRHMISHLSAGET---ICQVCFQIFPSGEHLEKHMDVH---LYICGVCGEKFRLRKDMRSHY 669

  Fly   616 TTMH 619
            .:.|
Zfish   670 NSKH 673

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 20/79 (25%)
RRF <161..222 CDD:294170 15/57 (26%)
zf-C2H2_8 454..530 CDD:292531 22/104 (21%)
C2H2 Zn finger 485..505 CDD:275368 7/48 (15%)
zf-H2C2_2 497..522 CDD:290200 9/31 (29%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/25 (40%)
C2H2 Zn finger 541..562 CDD:275368 5/22 (23%)
C2H2 Zn finger 571..591 CDD:275368 5/20 (25%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
zbtb1NP_999962.1 BTB 14..118 CDD:279045
BTB 25..121 CDD:197585
C2H2 Zn finger 544..564 CDD:275368 5/23 (22%)
zf-H2C2_2 556..581 CDD:290200 9/25 (36%)
C2H2 Zn finger 572..592 CDD:275368 6/20 (30%)
C2H2 Zn finger 600..618 CDD:275368 4/18 (22%)
C2H2 Zn finger 652..668 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.