DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and si:dkeyp-113d7.1

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_999959.1 Gene:si:dkeyp-113d7.1 ZFINID:ZDB-GENE-030131-755 Length:498 Species:Danio rerio

Alignment Length:401 Identity:93/402 (23%)
Similarity:146/402 (36%) Gaps:98/402 (24%)


  Fly   287 DPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTD-NGEIYIINSA--SSEDQNQDSTP 348
            ||....|:::    :.....||.|.|..::.:.|.|.:.:: :.:::..:|.  .|...:.:.:.
Zfish    73 DPIRTVDLSV----IQPLSTAELGSDQIKMEISGLDYIKSEHHSDLHSFHSTELGSYKSHYEPSL 133

  Fly   349 EFD---------------QDNGITSYNIKEDGEIQFSGE-------------------------- 372
            .||               ..:.:.||...|.|.|:...|                          
Zfish   134 VFDYISHVSDSLEYIKSEHHSDLHSYYASELGTIKTEYEPIFMTSHIKTEMNGLESIHMAELRTE 198

  Fly   373 ----KPEEIEDVVVFNLGEEISQEQ--QVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQE 431
                :||.:.| .:..|..:.|...  ::.|.|.|...............|..||          
Zfish   199 LDKLRPETLID-GIGKLDSDFSSNSLYELTSVHANKAQAAHHPTSTKGHGPTPRK---------- 252

  Fly   432 SSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIK---------GLKSGKGGTLK--- 484
               |:..||.     |.|.|..|...|.|...|..|...|..         |...|:.|.||   
Zfish   253 ---PRNPTGE-----KPFSCTQCGKNFSTLGNLKTHKRIHTGERPYTCSQCGKSFGQAGNLKRHQ 309

  Fly   485 ----------CPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRH 539
                      |..|....:.|..|:.|..:|||.|||.|:||..||||.:.||.|..:|||.:..
Zfish   310 LIHTGQKPYTCAHCPKGFTKADDLRSHQRLHTGEKPFSCAECGKSFSQTKELKAHQLSHTGERPF 374

  Fly   540 QCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGR 603
            .|..|...|:::::.:.| .::||| .:.:.|..|.:||::...|..|...|:|.. |.|.|||:
Zfish   375 CCSLCGKSFSKETSYRNH-QQIHMG-EKPYSCSQCGKSFSNSGVLKTHEKIHSGERPFGCTQCGK 437

  Fly   604 QFNDRSAVQRH 614
            .|.....::.|
Zfish   438 HFGRLGHLKAH 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 32/98 (33%)
C2H2 Zn finger 485..505 CDD:275368 5/20 (25%)
zf-H2C2_2 497..522 CDD:290200 14/25 (56%)
C2H2 Zn finger 513..533 CDD:275368 10/20 (50%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 4/21 (19%)
C2H2 Zn finger 571..591 CDD:275368 6/20 (30%)
C2H2 Zn finger 598..617 CDD:275368 6/18 (33%)
si:dkeyp-113d7.1NP_999959.1 COG5048 <260..414 CDD:227381 49/156 (31%)
C2H2 Zn finger 264..284 CDD:275368 6/20 (30%)
zf-H2C2_2 276..299 CDD:290200 4/23 (17%)
C2H2 Zn finger 292..312 CDD:275368 5/20 (25%)
zf-H2C2_2 304..328 CDD:290200 4/24 (17%)
C2H2 Zn finger 320..340 CDD:275368 5/20 (25%)
zf-H2C2_2 332..357 CDD:290200 14/25 (56%)
C2H2 Zn finger 348..368 CDD:275368 10/20 (50%)
zf-H2C2_2 360..384 CDD:290200 9/24 (38%)
C2H2 Zn finger 376..396 CDD:275368 4/21 (19%)
zf-H2C2_2 388..413 CDD:290200 8/27 (30%)
C2H2 Zn finger 404..424 CDD:275368 6/20 (30%)
C2H2 Zn finger 432..452 CDD:275368 6/18 (33%)
zf-H2C2_2 444..469 CDD:290200 1/6 (17%)
C2H2 Zn finger 460..480 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.