DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and zbtb14

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_998701.1 Gene:zbtb14 ZFINID:ZDB-GENE-040426-2946 Length:442 Species:Danio rerio

Alignment Length:396 Identity:96/397 (24%)
Similarity:159/397 (40%) Gaps:80/397 (20%)


  Fly   290 NNSDVNIDGLELD--EEV-----PAESGEDFREINMVGSDVVHTDNGEIYIINSASSE-DQNQDS 346
            ::|.:.||.:..|  |||     .|:.....:::|::.|      :|:|..|...... .|.:|.
Zfish    66 SSSVIEIDFIRSDIFEEVLNYMYTAKISVKKKDVNLMMS------SGQILGIRFLDKLCSQKRDM 124

  Fly   347 TPEFDQDNG-----------------ITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQ 394
            :|  |:.||                 :....:.:||::|..|::.:...|               
Zfish   125 SP--DEKNGDPRNAKFPYDMVKMGLPMEDPPLNQDGDVQVLGDQDDTPSD--------------- 172

  Fly   395 VFSFHENVIIVEKEQNDRD-EQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAF 458
                    .|||:.|.:.: :::|....:..|.:.|:.:....||.|.....|::.......:|.
Zfish   173 --------DIVEEAQGNHELDKSPNNALQVQEAILKELAQEDVPKVGCYDQEVEALDGEPKELAA 229

  Fly   459 PTQKL-----------------LTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHT 506
            .||.|                 .|...:...:.|..|....|.|..|.......:.|::|..:|:
Zfish   230 HTQTLSFADSMGDVKDTQPPGWSTATADMKFEYLLYGHRDQLACQVCGKTFIDENRLRKHEKLHS 294

  Fly   507 GLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKC 571
            ..:||.|..|..:|:.:..||.|:..|||.|.::|..|...|.:..:|::| .||| .|.|...|
Zfish   295 ADRPFICEICSKAFTTQAHLKEHLKIHTGFKPYRCEACGKSFIRAPDLKKH-ERVH-SNERPFAC 357

  Fly   572 HLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKL--TDYISETN 633
            .:|.::|.|.|.|..|...|.|.. |.|..|.:.|...|.::||...||. :.||  :...|||.
Zfish   358 QMCEKAFKHKSHLKDHERRHRGEKPFVCNSCTKAFAKASDLKRHENNMHS-ERKLSGSGLQSETE 421

  Fly   634 EFQAVA 639
            :.||.|
Zfish   422 QLQAAA 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 21/93 (23%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 8/25 (32%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
zbtb14NP_998701.1 BTB 20..123 CDD:279045 14/63 (22%)
BTB 31..122 CDD:197585 14/62 (23%)
COG5048 <273..408 CDD:227381 45/138 (33%)
C2H2 Zn finger 273..293 CDD:275368 4/20 (20%)
zf-H2C2_2 286..310 CDD:290200 8/24 (33%)
zf-C2H2 299..321 CDD:278523 7/22 (32%)
C2H2 Zn finger 301..321 CDD:275368 6/20 (30%)
zf-H2C2_2 313..338 CDD:290200 10/25 (40%)
C2H2 Zn finger 329..349 CDD:275368 7/21 (33%)
zf-H2C2_2 341..366 CDD:290200 10/27 (37%)
C2H2 Zn finger 357..377 CDD:275368 7/20 (35%)
zf-H2C2_2 369..393 CDD:290200 8/24 (33%)
C2H2 Zn finger 385..401 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.