DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and CG7372

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_648789.3 Gene:CG7372 FlyBaseID:FBgn0036522 Length:971 Species:Drosophila melanogaster

Alignment Length:563 Identity:118/564 (21%)
Similarity:229/564 (41%) Gaps:97/564 (17%)


  Fly   108 DEDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRL-ELRAKLTTE---LRK 168
            |:::|...:.:..:...::|:|....|            ::|.::|..: :.|.:..|:   ||.
  Fly   316 DKEDLTMINDMVAVIAAERVKKTSSSK------------VNKMIIKLPMPKKRGRKRTKPESLRD 368

  Fly   169 ELAEEVRSEVRKEL-AEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDGS 232
            |.....:::.:|:| .||.:..|.:.|:.:.:.:..:.........::|....|.:.:..:....
  Fly   369 EQDNAEKTDKKKKLNKEEGQQPVLEPLQAKKTSNQAENGATQSNNVVKVQQNAKGSKKDGTQSAQ 433

  Fly   233 EPETKPQVKEDA-SPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVN- 295
            :.||.|:..|:| :.|:..|:::..:. ::.|..|...||.|...:::.  ..|....:.|:.| 
  Fly   434 KSETNPKHLENAETNSKDNTESVALKE-TIHDKQLTIDEAGKAGTQKDD--NSNQKQLDKSEANA 495

  Fly   296 -----IDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEF----D 351
                 :|  ::.:::|.||.:|.:::....::......|          ..:.:..||..    |
  Fly   496 GKSKMVD--QVHQQMPVESAKDHQQMTEEPTNSTKRKRG----------RKERKSPTPVLIPLGD 548

  Fly   352 QDNGITSYNIKEDGEI-QFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQ 415
            ::       |||:.|: :....|..:..|.||     ||..|::     ::..:.|.|.:|....
  Fly   549 KE-------IKEEPELPERRMRKSRQHVDYVV-----EIKDEEE-----DDDEVEEAEVDDDSSA 596

  Fly   416 TPLKRKRSSELVF---KQESSCPQPKTG------------------RITDTV------KSFQCHL 453
            |......|::..|   |:|||......|                  |:.|.:      |.:.|..
  Fly   597 TISPHNSSTDESFTSIKRESSEESQHNGIGGIHTCNFCGKTFKRFSRMQDHLRLHTGEKPYVCGQ 661

  Fly   454 CPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECEL 518
            |..||..:..|..|...|    ::.|  ..||..|::.|:....|..||..|...:.:||.:|..
  Fly   662 CGRAFRLKMRLVEHQLRH----RAEK--AYKCDICSMPLATKQDLSLHMRHHKNDRRYKCDKCNK 720

  Fly   519 SFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSG 583
            .|.:...|..|:..|||.|.:.|..|...|..:.||..| .|.|:|: :..:|.||.:.|.....
  Fly   721 GFVRSSDLSIHVRIHTGEKPYSCDLCGKAFRARQNLVVH-RRTHLGD-KPIQCELCDKRFARKID 783

  Fly   584 LSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHKVKNKL 625
            :..|:..|.|.. ::|..|.|.::.|..:.||....|.::.::
  Fly   784 MRVHMRRHTGEKPYNCDACQRGYSSRVNLLRHQEREHGIEEQV 826

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 23/140 (16%)
RRF <161..222 CDD:294170 12/65 (18%)
zf-C2H2_8 454..530 CDD:292531 21/76 (28%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 8/25 (32%)
C2H2 Zn finger 513..533 CDD:275368 5/20 (25%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 5/20 (25%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
CG7372NP_648789.3 COG5048 <594..787 CDD:227381 50/201 (25%)
C2H2 Zn finger 631..651 CDD:275368 2/20 (10%)
zf-H2C2_2 644..666 CDD:290200 5/22 (23%)
zf-H2C2_2 699..724 CDD:290200 8/25 (32%)
zf-C2H2 713..735 CDD:278523 6/22 (27%)
C2H2 Zn finger 715..735 CDD:275368 5/20 (25%)
zf-H2C2_2 727..750 CDD:290200 8/23 (35%)
C2H2 Zn finger 743..763 CDD:275368 7/21 (33%)
zf-H2C2_2 755..780 CDD:290200 10/27 (37%)
C2H2 Zn finger 771..791 CDD:275368 5/20 (25%)
zf-H2C2_2 783..808 CDD:290200 6/25 (24%)
C2H2 Zn finger 799..816 CDD:275370 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24377
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.