DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31365 and Meics

Sequence 1:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_524062.1 Gene:Meics FlyBaseID:FBgn0025874 Length:583 Species:Drosophila melanogaster

Alignment Length:479 Identity:117/480 (24%)
Similarity:180/480 (38%) Gaps:111/480 (23%)


  Fly   226 WESLDGSEPETKPQVKEDASPSR--------------------------SKTKALPKRRPSLVDA 264
            ||.|:...||. .:||.|..|.:                          |:...|.|.     ::
  Fly    45 WEMLNSILPEI-CRVKRDEMPQKICPTCLVAAQNAFHFRHKCEQSFQFFSQLLQLDKS-----NS 103

  Fly   265 NLKATEARKDAKEEEF---ILGCNTDP---------ANNSDVNIDGLELDEEVP-----AESGED 312
            ||..:..|:.......   |:||. ||         ||..||..|   :||...     .:..|.
  Fly   104 NLSRSHCRRGTMNPLIPFEIVGCE-DPLDTNVTKLDANRPDVKTD---IDEPTDGKATNGQESEP 164

  Fly   313 FREINMVGSDVVHTDNGEIYI---INSASSEDQNQDSTPEFDQDNGITSYNIKED---------- 364
            .:|:..:..:.:.|:: |:.|   ...|..|:.:.::|....:|:...:....||          
  Fly   165 LQEVFEITMNDIKTED-EVSIQETFEDAFDEENDNNNTDSEREDSDQWTVGSTEDQDEPWIPGGG 228

  Fly   365 GEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRD---------------- 413
            |.....|..    :.::....|...| .|:..:.|   :...|||.|..                
  Fly   229 GRQTVGGNN----QSLLCTECGVSYS-TQKALARH---VAKHKEQGDTQKPHLCDFCGRGFRTNA 285

  Fly   414 EQTPLKRKRSSELVFKQESSCPQPKTGRIT--------DTVKSFQCHLCPVAFPTQKLLTRHHNT 470
            :.|..:|:.:.|..||. ..||:..|...|        |..|..:|..|...|.|:..|..|...
  Fly   286 QLTTHRRRHTGERPFKC-PLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQR 349

  Fly   471 HIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTG 535
            |     :|: ...|||.|....:..|.||.|..:|...:||||..|...|.|.:.|..|:..|.|
  Fly   350 H-----TGE-RPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNG 408

  Fly   536 VKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCK 599
            .::.:||.|...|.:|||:.:| .|.|.| .:..||..|.::|:|...|..||..|.|.. :.|.
  Fly   409 DRQFKCPDCDKSFFEKSNMMKH-QRTHSG-IKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCD 471

  Fly   600 QCGRQFNDRSAVQRHVTTMHKVKN 623
            |||:.|:...::.:|  |:..|.|
  Fly   472 QCGKGFSANQSLMKH--TLWHVDN 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 8/18 (44%)
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 25/76 (33%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 8/24 (33%)
C2H2 Zn finger 541..562 CDD:275368 9/21 (43%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
MeicsNP_524062.1 zf-AD 21..95 CDD:285071 10/51 (20%)
C2H2 Zn finger 242..262 CDD:275368 4/24 (17%)
C2H2 Zn finger 274..294 CDD:275368 2/20 (10%)
zf-H2C2_2 287..311 CDD:290200 8/25 (32%)
C2H2 Zn finger 302..322 CDD:275368 4/21 (19%)
C2H2 Zn finger 330..350 CDD:275368 6/20 (30%)
zf-H2C2_2 342..366 CDD:290200 8/30 (27%)
C2H2 Zn finger 358..378 CDD:275368 7/20 (35%)
C2H2 Zn finger 386..406 CDD:275368 6/20 (30%)
COG5048 <395..583 CDD:227381 35/104 (34%)
zf-C2H2 412..434 CDD:278523 9/23 (39%)
C2H2 Zn finger 414..434 CDD:275368 9/21 (43%)
zf-H2C2_2 426..451 CDD:290200 9/27 (33%)
C2H2 Zn finger 442..462 CDD:275368 7/20 (35%)
zf-H2C2_2 454..478 CDD:290200 10/24 (42%)
C2H2 Zn finger 470..486 CDD:275368 5/16 (31%)
C2H2 Zn finger 500..520 CDD:275368
C2H2 Zn finger 532..552 CDD:275370
C2H2 Zn finger 559..579 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24377
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.